SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004081 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004081
Domain Number 1 Region: 16-209
Classification Level Classification E-value
Superfamily L domain-like 8.84e-35
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 508-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-23
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004081   Gene: ENSTRUG00000001774   Transcript: ENSTRUT00000004103
Sequence length 664
Comment pep:novel scaffold:FUGU4:scaffold_275:74521:88841:1 gene:ENSTRUG00000001774 transcript:ENSTRUT00000004103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVEKALEEAAVSGALNLSNRRLKEFPRSARNYDLSDITHADLSKNRLCELPEELCQFMS
LETLSLYHNGMRSLSPSLSNLQALTYLNLSRNLLSSLPPSVFQLPFLRVLIISNNKLCSL
STSIYALTHLRQLDVSCNELQSLPPELGQLECLRDLNLRRNLISITVNKISELPLVRLDI
SCNGISHVPLCYRHLRHLQSISLDNNPLQMPPAQICSKGKYHIFKYLNMEACKRNQEELE
RHLRPTGFSTCLTEQELFTGQIGLLDSGFNSVESGSKRWSGNESTDDFSERSLRMTEVSR
DQMNLEEEQEEDGFSLKTVNGGTDHLDSTESSMTEVEEDVGMEPPPPLTAPPSFYVEEGP
PSPSSSSSDDSSPLSPSSPTIDQRKKPGTLLIWQERERLQQQREKARKKLMSYHRTANNN
NVPQSKTCRSKVPAHILAGGSCTSNMGTKPSDSDMTSSQKMSPPSSQAQKPNSFLFRASS
HSNVRPTGSAYALRESGRSESCMALRSPKEERPEITQLRKTLESHLKITLPEDLGEALSN
GTVLCQLVNHIRPRSVSIIHVPSPAVPKLSTAKSRVNVESFLGACRKLGLPEKAVCTCSD
VLLSNLSPVLDCVTALLAVECEGVVGEKWSHSSSPSSSLLSLDFLLFYCAAMALLCVLYC
YLLT
Download sequence
Identical sequences H2RVB3
ENSTRUP00000004081 ENSTRUP00000004081 31033.ENSTRUP00000004081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]