SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004371 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004371
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.01e-80
Family Calponin-homology domain, CH-domain 0.00000253
Further Details:      
 
Domain Number 2 Region: 1002-1159
Classification Level Classification E-value
Superfamily Spectrin repeat 6.89e-26
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 3 Region: 527-670
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-20
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 402-556
Classification Level Classification E-value
Superfamily Spectrin repeat 5.43e-20
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 2734-2868
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 2636-2773
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-18
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 2170-2286
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-16
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 8 Region: 779-940
Classification Level Classification E-value
Superfamily Spectrin repeat 4.4e-16
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 9 Region: 1220-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-16
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 1525-1681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000247
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 11 Region: 1633-1777
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000446
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 12 Region: 1837-1972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000366
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 2882-3017
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000331
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 14 Region: 2510-2643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000048
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 2012-2113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 16 Region: 2293-2409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000013
Family Spectrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000004371
Domain Number - Region: 1447-1562
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000887
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2454-2522
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00168
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 723-797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004371   Gene: ENSTRUG00000001903   Transcript: ENSTRUT00000004395
Sequence length 3051
Comment pep:novel scaffold:FUGU4:scaffold_36:6262:97481:-1 gene:ENSTRUG00000001903 transcript:ENSTRUT00000004395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWTIVTCDEREDVQKKTFTKWVNSQLTKTGKPPVEDLFSDLCDGRRLLQLLEGLVGHQLV
RLERGLTRVHSLNNVNRALQILQKNNVELVNIGAADIVDGNHKLILGLIWSIILHWQVKD
VMKDVMAGLQQTNSEKILLSWVRQNTRQYPQVNVVNFSSSWNDGLAFNALIHSHRPELFD
WSTVERKTSVIDKLEHAFNTAEQHLGIDRLLDPEDLAVPHPDKKSVIMYVTSLFRVLPQS
VSMEAIKEVETLPRAAPANVSRVTTEEHYEIQTQQRFSQQITVNVAQGRVQSPSPQPRYK
SYAYTQAAYVKSPEQKRRRFTDQFLSPGQEELQRGLSPLPPGSTTLESYQTALEEVLTWL
LSAEDGLQAQPPISSNVEEVKEQFHTHEGYMVELTTHQGSVGRVLRAGAALLAEGNLSEE
EDSEVREQMNLLNSRWEHLRVASMERQSRLHEVLMDLQHKQLQQLTDWLDVTEARINKMG
ARPLGPDLEDVKHQVEEHKLLQEDLEMEQVRVNSLTHMVVVVDDSSGDSATAALESKLQV
LGDRWAAICRWTEERWILLQEILLKWQHFTNEQCLFDSWLTQKEELVRSIKTSNLKDHAE
MVACLRRLTTVKADLEAKRPTMDKLCSMSQDLLSSVKNKEVASKLEARLDSFAQRWDRLI
QSLELSISQLSSAVNAPQESELTHSVTATVTKVITREKVSAVRQTRESPPPQKKRQVAVD
SELRKRFDVDFTEVHSYMTRGEAILQSPEFSLSRKDGSIQELHDKVQAIERERPEKYRKL
QEATRTAQTLVEQAPPEGSRADDIAQAAEQLNQRWVGFCALLSDRLAWLAFQAKVLAFYS
LYEQCEQAVENSENWLKVQSPPASEPEPLKVQLERCQEEVARLVALQPQVDLLEKRLNEL
KGEKRCEEDPSAFLDADITAFKEHYSKVLEDLRTRERQLQLVLESLPPARYKETISILLA
WLQQCEAKLAIPSTAVTEYPIMEQRLKDVQALQGSLVEHQSKVDYLNSAVEQVFQKAPPD
ISMKYHAEMDAIMGRWRRLGTTLGDNAQRIQELMAKLMQFENDVKTLKKWMSDVDVFLNE
EWPALGDSEALEKQLEQCTALVNDIHTIQPSVNGINEVGLFLKKEAEPPFAIYIQKLLDE
LNSQWENVCKQAYAKKSALKGGLDKTMALRKEMQEMQEWINQAEEDYLERDFTYKTPEEL
RKAVEELKTAQEEVHSKEQKVKLLTDSVNSFISKAPPTAHDALRSELDMLTSNYQRLCSR
LDGKCKTLEEVWACWCELLSYLEQESKFLDQLEQKLDEIENLQGGAEELQEALDSLESLL
QHPEDNRNQIRELAQTLMDGGVLDELIQQKLEAFNTRWDELMARAALKQKELEKSVQWAQ
ENDKTLRQIQESLANTDRHLSAYLADHIDAQQIPQEAQKENPNLSSVKATLEEMRKKRQD
KEPSQRTMGQIDLTQKMLTDVWTKFRLFQKPANFDARLTECEQALNGVKGQAGLLEIGSV
EHDVVQSQLEQCMKLYKVLSEVKGEVETVIKTGRQIVQRQQTEQPKELDDRVTALKLLYN
QLGSQVTESKLALEKILKLSRKLRKELNGLTEWLATTDAELTKRSSVDGMPSDLDAELSW
AQSVHDEMERRQPQLQAVVDLAEALKALLHGHGSLVDDKVSLLRCNWIAVTSRAEEWLNL
LLDYQRQMKKLDGGIAEVNGWIDGAEKKMNEMDGQGPNDAGLKVLRAELELTRGKMEEVG
ALAQELMSSRGENCQAQVRPRVEQLNQRYDTIAQRITCGLTAASAKELEQYHSEAQIWLD
LLEEEVKQGENLKEEDFQENKVAHKNTDPQDCEEGAVKELLMKGENLQKRVPDEDKREQL
RLKHNQLNSKYNTVKDLRALRNRKALAIAPQWYQYRRKSHDLLAWLDDIQRSVDQLPDPP
EGERVKEIGSEFDTKKEELKEVQGLASQLSQAGAANLVEPRQLQLNKRWVEVEGKFIPFK
RQSLRLLSTLHTASSILASADSSKQIGYAKTEYLTELQALLQSVSETDFKLNSPEYWPAA
YYNLPQQEHCLKEVKESIDGLKGPVGEALARREQMLSGARATEGQRIQDTTSLLSTNWDK
LNKLHQDRFKRWQDCNCKWQKFISDQKVMEEWLIGAESALKLGESEPAAHRQHLRDLTEA
IPIQEVVMCRVNSTGEDICKLSTPDDASRLQTQLKFLNTHWANVCQQLNERKRRSAEAHS
AAASLQEDMGSMLGWLDKAETVLAVPLHPAEPQHIRNTLSKVQAHVEELPSKKAAMEHLN
SRHRQITIPADRQRDIRTINTRWAEVSRALPERQLEIEGLLMDLEKLQSQLDDLSAWATS
TRTKLEQSPEEQPPKLNEEVQVKEPIIESVLNQANQLYKDSPPNQPDKMKYTKLKEDWMV
IVELLRQHKERTAELLLSKKSRLIVCVCVCVCVCVCVCVSGEALTGSSVPESAALAQFNK
SWAELSDWLAMLDNMVHNKRVVVADLDDINENIGRLKVSLQELEQQRPLLEKQVTAAQNL
KNKTSNQYSRNAITERIDRLQAHWEDSHTKLLDRMKQLHNMQQDSIDWLDAKKRVDVHIS
RASDRLESWLEITYTVDELKKQNAELKVFMKELQQWQGQVDETNALADNLLTLYANDDTH
KVTQVNNNMMATWTHISKRVSDRKTALEAALKLLQQFYLDLDKFLNWLTEAETTCNVLID
ATNKERLPEQPAAKNLLAQWKDLQAEIDSHTELYHSLDENGQRIVTSLGDTEDAALLRRR
LDNMSQRWNDLRTKTLSMRAHLESEMAPWKRLHMSLQELLNWLRLRNQQLEKEPPVGGDV
PAVQAQLDTHRGFRRDLRAKEPVVIKALDDVGMFLSELPRDTPSPEQRDISPEERAQNVG
RVIRKEADDVIMKWDRLNTDSVEWQKKLELALDRLMELQEAEDLLDGQLRQAEMVKEAWE
PVGDLLIESLPENIDKAKEFQEEIAPIKDDVTHMNQLASTFGPHDIQLSPANLERIDDLN
TRWRLLQISITEHLKQLTDAHRDFGLRHVSAGSVESPFEQGISPNNVPYYI
Download sequence
Identical sequences H2RW51
31033.ENSTRUP00000004371 ENSTRUP00000004371 ENSTRUP00000004371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]