SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004413 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004413
Domain Number 1 Region: 307-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-46
Family SPRY domain 0.0000726
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily RING/U-box 4.52e-19
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 91-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000168
Family B-box zinc-binding domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000004413
Domain Number - Region: 137-232
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0175
Family Fibrinogen coiled-coil and central regions 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004413   Gene: ENSTRUG00000001917   Transcript: ENSTRUT00000004437
Sequence length 475
Comment pep:novel scaffold:FUGU4:scaffold_256:55615:57806:-1 gene:ENSTRUG00000001917 transcript:ENSTRUT00000004437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGPSDPRPPLQQDLTCSVCRGIFSDPLVLPCTHSFCRECLRKSTRFNGEQCPLCREKF
TTSQAIPNRVLSQVCQSFALYPPQGSVPGPGSEAACNLHLKPLLLYCEKDEQPLCVDCVA
LHNTHKLWPLTEAVSICKRELEFKVQILEWKVDSYKKLTESLDSTVESIRNQAQEAEQQI
HQEFQRLHDALLTEERLRLEALAAEEGQKIAALQELSGTIRQDVAGLRKLVDSVKRETGN
EDVPLLQVGSSFSTTTGQQRQAAFLHHLILLSVSEFPGFEKKNMGKHVGALSFKIWTSLQ
EHVKCSPVVFDPNTSSPWLSVSADLTTIKESPERLVTPDNPERFDPCVFVLGAEGYTSGK
HRWDVIVGDSPSWIVGVCKESVARKKKFTLSPSRGVWFLGLSKEMERTALQVQQRPERIR
VKLNMERGEVSFWDGESSNHLVTLTHHFNEKIFPFFGPGLHNTPMILAPAKITVH
Download sequence
Identical sequences H2RW93
ENSTRUP00000004413 31033.ENSTRUP00000004413 ENSTRUP00000004413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]