SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004542 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004542
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-42
Family Calponin-homology domain, CH-domain 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004542   Gene: ENSTRUG00000001967   Transcript: ENSTRUT00000004567
Sequence length 204
Comment pep:novel scaffold:FUGU4:scaffold_4717:521:2540:1 gene:ENSTRUG00000001967 transcript:ENSTRUT00000004567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKGVGMANKGPSYGLSRQVQDKIDSKYDPELEQILVEWISRQCGADVGRPEPGKLGFQ
AWLKDGCILCQLVNSLFVGDKPVKKIQNSTMAFKQMEQISQFLKGAEAYGVNKTDMFQTV
DLWEAKDLAAVQRTLSALGSLAVTKDEGTYQGDPNWFFKKAQENKREFSDEQLKAGKNVI
GLQMGSNKGASQEGMSYGRPRQIM
Download sequence
Identical sequences H2RWM2
ENSTRUP00000004542 XP_003979741.1.43653 ENSTRUP00000004542 31033.ENSTRUP00000004542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]