SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004552 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004552
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-33
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 2021-2158
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000447
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 
Domain Number 3 Region: 2050-2097,2168-2254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000052
Family Nucleotide and nucleoside kinases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004552   Gene: ENSTRUG00000001974   Transcript: ENSTRUT00000004577
Sequence length 2385
Comment pep:novel scaffold:FUGU4:scaffold_167:342874:438102:1 gene:ENSTRUG00000001974 transcript:ENSTRUT00000004577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLAKSGCPRLIKDLSQDVTDGVLLAQIIQIIANEKVEDINGSPRSQSQMIE
NVDACLSFLDARGVNVQGLSAEEIRNGNLKSILGLFFILSRYKQQQQQQQQYYQSLVELS
QQTSSSTSSASSLKTQEMQSSVNSTPESPTKSYQHDLLQGQLEMDFVADTKKHTSNPRLL
RSEITLAMCVLYMLPGPSRVSAAGSGVSRSPGSSNLNRRSQSFNSIDKNKPLHSKPVMPI
NQQREEAARGLPAAGGMNGSGTGGTVTTSLSGQQLASAIPSPNASKSWRSKSMNLKHSAT
SSMLASPTHTPSQRMLGGAGPQRSMLDKFRLINPRSASRASPSVAEMALQEEDDLSECGE
DGLPPSGSVCGSVSSSATSKQMPTKTPGSSVTAPTKASSSSSSYSKASNGNRPTSKDKEE
KGRSGKSKESEPSKEERDAYSDPTKKSSKIASLIPKGGKLSSTKKDGSSSVSSGIPKPGL
KPPSTTTSKSQNQSQGQSQVALNSSGNMRGGEGPKLSKGGGPSGSFYVQRSVGGSEAKRT
SMTSSTSTSALSGSTGMLGGGGGVGGAAPGGNGVVQLPQQQQHNHPNTATVAPFMYSSRT
FSENDCTTVAPVDPCLSPTKGEFVYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLE
ETMSSLRGTQISHSTLETTFDTTVTTEVNGRGLPALTTRSSPMAWRLGQSQTPRLQAGDA
PSMPSSYAPPRGSTTGSGTTAGRYSGHSDPSRLEISQRGSKEVPGDIDSGKNDSSKLWGI
EDNFGGHSNSWFLLVKNIKVSAGEICNISAGSATKRLRRLPDSKSVGRKSILHRASGQLG
YGGPISDFWDDSSSVSSGLSDTLDNISTDDLNTPVYSAGGSSRKSGGGGGGGGAQVQKGS
RSKHAEPEVSTSWAGAQDLKKVEEELDTGMDPSSGSSRWKSSSSSSSQAQCQYEETGQKA
AALAQMSQTGSWRRGMTAQVGITPPRSKGTSAALKTTGKTDDAKASEKVKVPSKSSAGIQ
RSPSDAGKSSGDEGKKPPSGIARPPAAGSFGYKKIPGPTGALITSSGATLTSGSATLGKA
PKSSAAIGKGTGVAAVRKTSLDGSQPQDDGVLLSCSGSKVTLQYRSLPRPAKSSSGAAAA
RSGHRSSSSSIDSNVSGKSAGGAATQAGAKRRDGKISDRSSPITINQTDKEKVSVTDQDP
AGGLSTSPKSSPTSSSASQSGLRQPGSKYPDIASPTFRRLFGTKASSKASSPGTPDSGKC
PSILGSPHGTLARQASLDSPSSGTGSLGGLSGGSSPLYGKTPDLCTDSPASSPASGLSLP
SNARPWPVCSSSAGSKDTLSCQSMTSLHTSSESIDLPLGHHGPKVTRTGSVKSTLSEGFT
DYYIDRTDDNQLSIRSLSFLCCRPLYCDALLSSSSVSVMPLDRNTLPKKGLRYPPSSRQA
SHEEGKEWLRSHSTGGLQDTGSQSPLSPPGASCTNAGKYHYSNLLSPTNINQYNLPPGSG
SMSRSNSIPAQDSFDLYGEGHPLGGSANSLEERPRAISRSGSFRDSTDEGHPFLSSTFPV
HGSSLSLVSSTSSLYSATEEKAHSEQIRKLRRELDASQEKVATLTSQLTANAHLVAAFEK
SLSNMTCRLQSLTMTAEQKESELVELRETIETLKTQNTDAQTAIQVALNGPDHLHKGNKE
ISLSSSDLRIRRQHSSESMSSINSTASHSSMGSLGKDAEDKKKKKKSWVLQLRSSFKQAF
SKKKTKSQSAHDEMEEMTDSLPSSPKLQHDNRQGSVATLRSSPSTTELCECTEAEAEIVL
QLKNELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIETLKAENDRLKSSGNATPT
ATPVKTARPPSETSSTSSSSSRQSLGLSLNNLNITDTIILAQILLLLMTCSPPLEGGKAF
FSVQRKMRVKESVETHLWFYKCVGQSDNMSQDVATNKDRSLYLEYVFRVDPHTSLGLSSD
SIVCYRMGEVVRSHASEVPELLPCGYLVGDNNAVPSSILGVKENSIDSLVFDTLIPKPIV
QRYLNLLMEHRRIILSGPSGTGKSFLATKLAEYIISQMGQEVTEHNVASFSVDQNSSKEL
RQYLSSXAEQCNSEETDTELPTVVILDNLHHIGSLSDIFNGFLNCKYHKCPYVIGTMNQG
VSTSPNLELHHNFRWVLCTNHTEPVKGFLGRFLRRKLIETEINKNMRSNDLIKIIDWIPR
WQHLNCFLEAHSSSDVTIGPRLFLSCPMDVEGSRVWFTDLWNYSLVPYLLEAVREGLQLY
GKRAAWEDPSKWVNDTYPWNATSLQREGQSLLQLRPEDVGYDGYSSSKEGASSKQVSQSD
TEGDPLMNMLLRLQEAANYSSTQSCDSDSTSHHDEQLDSSLESAL
Download sequence
Identical sequences H2RWN2
ENSTRUP00000004552 ENSTRUP00000004552 31033.ENSTRUP00000004552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]