SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004605 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004605
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.98e-44
Family Calponin-homology domain, CH-domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1210-1321
Classification Level Classification E-value
Superfamily E set domains 1.53e-34
Family Filamin repeat (rod domain) 0.0000242
Further Details:      
 
Domain Number 3 Region: 1410-1518
Classification Level Classification E-value
Superfamily E set domains 3.4e-32
Family Filamin repeat (rod domain) 0.00000406
Further Details:      
 
Domain Number 4 Region: 943-1036
Classification Level Classification E-value
Superfamily E set domains 6.41e-30
Family Filamin repeat (rod domain) 0.00000898
Further Details:      
 
Domain Number 5 Region: 1025-1129
Classification Level Classification E-value
Superfamily E set domains 4e-29
Family Filamin repeat (rod domain) 0.0000604
Further Details:      
 
Domain Number 6 Region: 1324-1433
Classification Level Classification E-value
Superfamily E set domains 5.27e-29
Family Filamin repeat (rod domain) 0.0000283
Further Details:      
 
Domain Number 7 Region: 625-749
Classification Level Classification E-value
Superfamily E set domains 2.8e-28
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 8 Region: 345-451
Classification Level Classification E-value
Superfamily E set domains 4.34e-28
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 9 Region: 1921-2014
Classification Level Classification E-value
Superfamily E set domains 6.42e-28
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 10 Region: 1737-1830
Classification Level Classification E-value
Superfamily E set domains 1.73e-27
Family Filamin repeat (rod domain) 0.00000983
Further Details:      
 
Domain Number 11 Region: 1120-1230
Classification Level Classification E-value
Superfamily E set domains 3e-27
Family Filamin repeat (rod domain) 0.0000342
Further Details:      
 
Domain Number 12 Region: 550-658
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 13 Region: 2194-2284
Classification Level Classification E-value
Superfamily E set domains 3.27e-26
Family Filamin repeat (rod domain) 0.00000876
Further Details:      
 
Domain Number 14 Region: 442-544
Classification Level Classification E-value
Superfamily E set domains 5.54e-26
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 15 Region: 2516-2606
Classification Level Classification E-value
Superfamily E set domains 5.6e-26
Family Filamin repeat (rod domain) 0.00000817
Further Details:      
 
Domain Number 16 Region: 738-846
Classification Level Classification E-value
Superfamily E set domains 1.4e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 17 Region: 1507-1617
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.0000824
Further Details:      
 
Domain Number 18 Region: 256-355
Classification Level Classification E-value
Superfamily E set domains 1.08e-24
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 19 Region: 2386-2478
Classification Level Classification E-value
Superfamily E set domains 1.27e-23
Family Filamin repeat (rod domain) 0.00000999
Further Details:      
 
Domain Number 20 Region: 156-253
Classification Level Classification E-value
Superfamily E set domains 1.87e-23
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 21 Region: 836-937
Classification Level Classification E-value
Superfamily E set domains 5.6e-21
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 22 Region: 2127-2208
Classification Level Classification E-value
Superfamily E set domains 2.14e-20
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 23 Region: 1841-1933
Classification Level Classification E-value
Superfamily E set domains 1.15e-17
Family Filamin repeat (rod domain) 0.0000829
Further Details:      
 
Domain Number 24 Region: 2292-2382
Classification Level Classification E-value
Superfamily E set domains 1.2e-17
Family Filamin repeat (rod domain) 0.0000323
Further Details:      
 
Domain Number 25 Region: 1664-1736
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family Filamin repeat (rod domain) 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004605   Gene: ENSTRUG00000002003   Transcript: ENSTRUT00000004630
Sequence length 2607
Comment pep:novel scaffold:FUGU4:scaffold_613:34199:53180:-1 gene:ENSTRUG00000002003 transcript:ENSTRUT00000004630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSKAIVDGNLKLILGLIWTLILHYSISMPMWGDEDDEDAKKLTPKQRLLGWIQNKVPQLP
ISNFHRDWRDGKALGALVDNCAPGLCPDWETWDPSQPVENAREAMQQADDWLGVPQVIAP
EEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRAKTLHPKRAKAYGPGVEPRGNMVLKPAE
FLVETVEAGLGEVLVYVEDPEGHTEEARVIPNNDKNRTYSVVYLPKVEGFHQVKVLFAGQ
DIDRSPFIVNVSKAMGDPTRVQARGPGLQQTGNVAGKPTYFDIYTAGAGAGDVGVIIVDS
NGRRDTVEIVLENRGDSIFRCTYIPVLEGPHTVHVTFAGHQIPRSPFTVHISEACNPNAC
RASGRGLQPKGLRVKEVADFKVYTKGSGSGELKVAVKGPRGDAEPVKVAEMNNGMFECSY
FPVTSGKYMVTISWGGHNVPRSPFEVHVSEEAEPQKVRAWGPGLEIGMVGKSADFVVEAI
GTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAH
VLPAANDALPENVKCSGPGLEPLGCIINKPADFIIDTCGAGRGELKLYAQDAEGFPFNIQ
MTDNGDGTFFCVYVPTKAIKHTIIITWANVNVPNSPFRVMIGEGSHPENVKVYGPGVEKM
GLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYMPPG
SGQYTIMVLFADQQIPISPFRIKVEPSHDAAKVRAEGPGLNKTGVEVNKPTHFTVYTKGA
GKAQPEVRFSTAGKGNVVRDFEIIDNHNYSYTVRYTAVQQGNMSVTVCHGGDPIPKSPFH
VSVAPLLDLSKVSIQGLNSKVDVGKDEDFMVRTKGAGGQGNLDVKILSPSRRPIPCKLES
GETNGVHTVTYIPPEEGAYRVDISYDGNPVPGSPFAVEGVLPPDPSKVRAYGPGLLGGLV
GKPAPFAIDTKGAGIGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINILFAE
QHVPGSPFKAVVQSPFDPSKVTVSGPGLERGKVNEDGSFTVDCSKAGEAELTIEIVSESG
AKAEVHVQNNRDGTYSITYIPPFQGLYTIIIKYGGCAVPNFPSQLLVDPPVDTSGVTVYG
AGVEPRGVLREVTTHFIVDARCLYKSGHDHIKACISNPSGATTDAYITDKGDGTYRVEYT
PYEDGLHLIDVLFDEVSLPKSPFRVSVAEGCDPSRVRAYGPGLEEGLVNTTNCFSVETRG
AGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGEYDVNITFGGLPIPGSPFSVPV
RELVDPSKVRCFGPGLGVGVRAHMPQTFTVDSSKAGLAPLVVQLYGPTGVAEPISVIDNN
DGSHTASYTPASDGAYTVCVKYADQEVPCSPFKIKTLPAHDASKVRASGPGLNASGVAAS
LPVEFTIDARDAGEGLLTVQILDPEGKPKKAHIRDNRNGTYTVSYVPDLTGRYTITIKYG
GDEIPYSPYRIHAVPTGDASKCLVTVSIGGHGPGSGIGPTIQIGEETVITVDAKAAGKGK
VTCKVTTPDGAELDVDVVENADGTFDIYYTAPEPGKYVITIRFGGENIPNSPFHVVVSLK
AQRVEERTQAWEWRSEVTGSSLTTFDSWATDDPTSPINGMEAVLRPFSLVIPFTVQKGQI
TGEVRMPSGRSACPHITDNKDGTVTVNYSPTERGLHEMEIKYDGSHIPGSPLQFYADAIN
SGHVSAFGPGLTHGTVNTLATFTIVTKDTGEGGLSLAVEGPSKADIACKDNKDGTCAVSY
LPTACGDYNIVVKFDDKHIPGSPFTAKITGDDVLRTSQLNVGTASDVSLKIMETDLRSLT
ASIRAPSGNEEPCVLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFRIMVGQSEI
GDASKVKVFGQGLVEGHTSEVAEFIVDTRTAGYGGLGLSIEGPSKVDINCEDVEDGTCKV
TYCPTEPGNYITNIKFADQHVPGSPFTIKVFGEGRVKESITRKRQAPPIASVGSTCDLNL
KIPGNWFHMVSAQERLTRTFTHSSHTYTRTERTEISKTHGGETTREVRVEESTQVGGEPF
RDVLTDLLGREGASSALNHSHPLSGEAGVQEMMAQVTSPGGKTEDAEIIKGEDSTYSVRF
VPQEMGAHTVNVKYRGQHVPGSPFQFTVGPFGEGGAHKVRAGGTGLDRGVAGVPGEFSIW
TREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFT
VPISTLADDARRITITSLQEMALKVGHEASFAVQLNGARGLIDAKIQNPSGATEDCSITE
LDTADQQAIRFVPRENGPHSIDVRLNGSHIPGSPFKIRVGELGQDGDPGLVSAFGSGLER
GTTGLASDFMVNTCNAGSGALSVTIDGPSKVKMDFQECPEGYKVSYTPMAPGNYLISIKY
GGPQHIVGSPFKAKVSGPHLSSGHGLHETSSVLLETVSKTSAASAAFASFPKFSSDASKV
LLRGAGLSKAFIGQKNSFTVDCSGAGTNMLMVGVHGPKAPCEEVYVKHMGNRMYNVTYTV
KEQGSYILIVKWGDENVPGSPFHVTVP
Download sequence
Identical sequences H2RWT5
ENSTRUP00000004605 ENSTRUP00000004605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]