SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005035 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005035
Domain Number 1 Region: 10-36,92-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.86e-41
Family G proteins 0.000048
Further Details:      
 
Domain Number 2 Region: 244-283
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000119
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005035   Gene: ENSTRUG00000002192   Transcript: ENSTRUT00000005065
Sequence length 334
Comment pep:novel scaffold:FUGU4:scaffold_2110:14709:19099:1 gene:ENSTRUG00000002192 transcript:ENSTRUT00000005065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSAESPYAYSSAPWRGQVNSEGMG
TLATSRNIRGAENRDGRQIRRPSVSVALIGHESPSLISGRCEGIDYKTTTILLDGRRVKL
ELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIREIDEHAPGVPRILVG
NRLHLAFKRQVPTEQARAYAEKNGMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKFWR
PNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSLAN
PAGGSKGNSLKRTKSSRPPQSPPQNCTRSNCKIS
Download sequence
Identical sequences H2RY15
ENSTRUP00000005035 31033.ENSTRUP00000005035 ENSTRUP00000005035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]