SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005090 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005090
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.52e-30
Family Motor proteins 0.0000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005090   Gene: ENSTRUG00000002219   Transcript: ENSTRUT00000005120
Sequence length 125
Comment pep:novel scaffold:FUGU4:scaffold_15:2211:2846:-1 gene:ENSTRUG00000002219 transcript:ENSTRUT00000005120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EECMFPKASDTTFKNKLHDQHLGKTKAFEKPKPGKGKAEAHFALVHYAGTVDYNISGWLD
KNKDPLNDSVVQLYQKSSNKLMSLLYAARAGDGMYLYSKLAGKKKGGSFQTVSALFRENL
GKLMT
Download sequence
Identical sequences H2RY69
ENSTRUP00000005090 31033.ENSTRUP00000005090 ENSTRUP00000005090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]