SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006183 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006183
Domain Number 1 Region: 63-261
Classification Level Classification E-value
Superfamily L domain-like 5.61e-37
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 2 Region: 654-764
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-26
Family Calponin-homology domain, CH-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006183   Gene: ENSTRUG00000002657   Transcript: ENSTRUT00000006221
Sequence length 783
Comment pep:known scaffold:FUGU4:scaffold_2175:8440:16844:1 gene:ENSTRUG00000002657 transcript:ENSTRUT00000006221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLLGSAENTGLHFTVGGGSSGARTGNVLVGSNNGLGSACPAPWNRSLDRALDEATA
TGCLNLSGRKLKEFPRSAANHDLTDTTRADLSRNRLSELPLEVCLFVSLESLNLYQNCLR
SLPDSLVNLQALTYLNLSRNQLSALPAIICSLPLKGLIACNNKLVSLPEELGQLRHLTEL
DVSCNEIQSLPPQVGQLEALRDLNVRRNHLLKLPAELAELPLVRLDFSCNKVTSIPACYR
QLTQLQSIVLDNNPLQSPPAQICIKGKIHIFKYLNLEASKTTPELSDYDKRPLNFSTCGD
ELCPGRLYGTLDSGFNSVDSGDKRWSGNEPSEELSELSLRVAEISRDQRPRGGAALLANG
TRESITSLGLWADVELEQIDFIDSCVEEEEEEGRSRARGGGDGTSLSSQFMAYIERRITR
EVPAPPLRLVWVSREEQLRPHRGPQEEPQQVALQLTRCTGCHSNSRPSNTFLCPRSPSSG
GLEKMRREAHLAALRYDEERQKTRYLQRDTKVPGPPTPAATLLQKAAPSPTASLTESENV
YPSRRSTHTDDSALFMSSSKSSCSSCFRLPPSLHLSLHLCPPPSLHLSLHVCLPPSLHLS
PSHTFSGGVASCRPASLRPESFLFRLTQKEEKRKGDAAPHSQVDNSAAPPLVEEDAELVE
QLRKNIEARLKVSCPDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRN
VENFLEACRRIGVPQSHLCLPLHILEERGLPQVAATVSALLDLAPPRHPITLASSTPGPS
VSM
Download sequence
Identical sequences H2S1B2
ENSTRUP00000006183 31033.ENSTRUP00000006183 ENSTRUP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]