SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006363 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006363
Domain Number 1 Region: 711-1013,1050-1104,1148-1204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-69
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1201-1320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000101
Family Motor proteins 0.011
Further Details:      
 
Domain Number 3 Region: 1545-1619
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000247
Family Motor proteins 0.017
Further Details:      
 
Domain Number 4 Region: 1617-1690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000146
Family Motor proteins 0.017
Further Details:      
 
Domain Number 5 Region: 1455-1545
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000345
Family Motor proteins 0.026
Further Details:      
 
Domain Number 6 Region: 1812-1913
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000109
Family Motor proteins 0.052
Further Details:      
 
Domain Number 7 Region: 2206-2275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000189
Family Motor proteins 0.034
Further Details:      
 
Domain Number 8 Region: 1987-2058
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000266
Family Motor proteins 0.027
Further Details:      
 
Domain Number 9 Region: 2686-2758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000234
Family Motor proteins 0.034
Further Details:      
 
Domain Number 10 Region: 1918-1982
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.028
Further Details:      
 
Domain Number 11 Region: 2276-2341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000743
Family Motor proteins 0.036
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000006363
Domain Number - Region: 2055-2126
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000319
Family Motor proteins 0.028
Further Details:      
 
Domain Number - Region: 2132-2206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000425
Family Motor proteins 0.029
Further Details:      
 
Domain Number - Region: 3025-3150
Classification Level Classification E-value
Superfamily ARM repeat 0.00253
Family Armadillo repeat 0.065
Further Details:      
 
Domain Number - Region: 2747-2816
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00451
Family Motor proteins 0.033
Further Details:      
 
Domain Number - Region: 1698-1802
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0162
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Domain Number - Region: 2553-2614
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0372
Family Motor proteins 0.032
Further Details:      
 
Domain Number - Region: 2926-2984
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0584
Family Motor proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006363   Gene: ENSTRUG00000002737   Transcript: ENSTRUT00000006403
Sequence length 3234
Comment pep:novel scaffold:FUGU4:scaffold_269:4818:21414:-1 gene:ENSTRUG00000002737 transcript:ENSTRUT00000006403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTLRLIQFSKAPFLTFGTVKLGTCRSTVLQIENPTEDVEAEVTVEKIPSNKGFSVDHSTF
TIQPEGSFCLTVTWTPTEEGGMRELIIFNANGVLKHQAVMLGRAEAPKKKKKSLWDSIKN
KTGSNQVAAPRRKVTDQPLKMASNKAFQVSRKPQYQRKKSRSPLASLDEGRPEAERPFSK
QIPQTSLQQKVLNSQSEENIYNMRRKSLHDPKLDGNRVSLSPDGMVSKPENQDLISMLNK
TLSPIGTPARLKKLMPHIYHESPLSAAVRPAASLDEADERATGTPILSVKEALALIDSDL
SHINSSPQDTSSSCGFSDSLESKTLQDSPHQPDACEQRLTFFVTKKGVSEVAGSEPIQKA
AFTSVTVTKAKAPVEANSLSGRKIRKSKRRLLEKTLELSGSSESGPGTPSLPVIDVDAGT
EACHDAQPQELSTSILCPRIQSLPTTISSPVASPLAVPSGLTSPFPFNTSILPSSPVGTS
SPLHPKLSSEPPPVQEDSFPVHMALKNKKRKSEEFLKSDEKIEDAGKTELAKRTRVVVCK
PEPCRPARKSTSQRRTADIISSIKKPVAILHSSQADFWRNSGLFLFLGPQSSKSSRAASV
KTSKIVAVAQSKLSFIKPTQNAIPRHPMPFAAKNMFYDERWIEKQQQGFTCWMNYVLTPD
DFKVNTEVAKVNAVSIVMGGGEDKFSVPKAPTKEEMSFSTYTARRKLNRLRRAACQLFTS
DAMVKAIQRLELEVEAKRLLVRKDRHLWKDIGERKKVLNWLLSYNPLWLRIGLETIYGEL
ISLESNSDVLGLAMFILQRLLWNPDIAAEFRHTKVPHLYKDGHEEALSRFTLKKLLLLVC
FLDRAKESRLIEHNPCLFCLDAEFKATKDLLLAFSRDFLSGEGILPRHLGYLGLPVSHVQ
TPLDEFNFAVKSLAVDLKCGIRLVRVMELLMQDWSFSAKLRLPAISRLQKIHNVDVALQV
LKDKGVDLKDDQGNIINSRDIVDGHREKTLNLLWKIIFAFQVDVMLDENQLREEISFLRR
TLRTKQRLALMRANQNLQLSSRPTSRPHEHSSVKISLLMDWVRAVCDFYKVKVENFTVSF
SDGRVLCYLIHHYHPSLLSDKAVSLLTTQTVECSLRGRLELDCSASESDNSFDSLPAGLN
GTRQSVEFKELLENEKSNFRLINTAVSFLGGVPAMINPSDMSNTIPNEKVVVLYLSFLCA
RLLNLRNETRAARVIQTAWRKYRLNKDLQLYKERNMAAVKIQKCVRNFLQKCRDKKQNQA
AVVIQAVWRGHAVRNGIKREKRARLQASQHKAATVIQAHWRTFMALKAFQKLRYYTIILQ
AQWRMRRASSAYGKLYWATTIIQTHWRARVLAKHDREYYCLLRAAVVKLQRGYRRWQLIK
TQKENHAAKVIQTVFKKWFKERMDARTTAAVRIQSWYRMQKCHVQYKKVQLSVVLIQRAF
RGHAVRKRVAKMKRAALIIQLWFRACVVRDVQRQTFVELRAAAITVQAAYRGKLARESLK
KQHGAATVIQAALRKYAARRRYLLLKKAATVVQQKYRATALARDTKKEYDAFRKAALTIQ
ANWRGRADRKKMEKQHQCATLIKAHYRRYKAQAEYRSKRAAAVVIQRYYRGYMAGKRIRN
AYLRMRAACITVQAGFRGMIVRAELKKQHRAATVIQTSVRMFLCKKQYLLLQSAAVIIQR
RYRALILGRTQQNKHRRLKQATVKIQAVYRGFRVREELKKRHVAARAIQTQFRMHRMRVA
YLATKYAAILIQERYRAKKLRDQQRRTYTTMKAAAGVIQAAYRGYRARREIAEMHQAATV
IQRRFFSIRERNKFLAIKTAVLFCQQRYRAVVMMRKVRSDYLSKRRAVISLQAACRGYLV
RRHLRIQQTAAVTIQSWFRKNQQRTYYQRLQWAASVMQERYRSNKIMKQEMLLLNAKKRA
AVTLQAAFRGMKCRRNLKRMHQAAHVIQRVYRACCQRKQYLALRSSVLIIQRRYRATVAA
KGEVKLYQRMRRAAVLLQAAFRGHRARKEVARWHQAATVIQSAFRSHRQQIKFQALRLSA
VIIQRCYRSHVLLRKERETFLKKRSSALVLQAAFRGHRVRRSISNMHRAATVIQAHFRRY
QAQAAFGRKRWAACVFQQRFRSQRQKNVEVQRYQDVRRAVLSLQAGYRRMKSRRVVKERQ
HAASVLQRAYRAHLHHKRYLRLRSCAVAIQRRYRATAAAKAERFQYLEMRSSAIIIQAAF
RRQQVRKEMDRRHQAATVIQSAFRGHREEARFQALRLSIITIQRCYRAHILQRRDREKFL
KMKWCTTTLQAAYRGWCVRRDVCRQHRAATRIQSCWRGSMQRRTFQRKRAAAVTLQQRVR
AVQRGRLERKKFTQMRQAAIVIQQYCRVWTARQQAFEMEKAAKRLRFTSAVFHHLCAMKL
QRALRAHWALKSAKNQIQSVIVIQVSSQSVLSVKNLLEKSSARWVKAKQQRRRYLEDRQK
VVVAQRAAQRWLRRRNKAASTIQQAVRKFLLLRRQKKFERGIIKAQVAESVSAWVGGDTN
AGLLTTCKAASHERVVILAILAKLXGLTWGRSPALVLQAAFRGHRVRRSISNMHRAASVI
QAHFKRYQAQAAFGRKRWAACVFQQRFRSQRQKNVEVQRYQLYKLGYRRMKSRRVVKERQ
HAASVLQRAYRAHLHHKRYLRLRSCAVAIQRRYRATAAAKAERFQYLEMRSLAIIIQAAF
RRQQVRKEMDRRHQAATVIQSAFRGHREEARFQALRLSIITIQRCYRAHILQRRDREKFL
KMKWCTTTLQAAYRGWCVRRDVCRQHRAATRIQSCWRGSMQRRTFQRKRAAAVTLQQRVR
AVQRGRLERKKFTQMRQAAIVIQQYCRVWTARQQAFEMEKAAKRLRFTSAVFHHLCAMKL
QRALRAHWALKSAKNQIQSVIVIQRWVKAKQQRRRYLEDRQKVVVAQRAAQRWLRRRNKA
ASTIQQAVRKFLLLRRQKKFERGIIKAQALWRGHRSRRLNEDLKVVKLRQRLRQLSANVR
EEDRLGNKTSSALDYLLRYKHFSYILEALKNLRPPPGCPPVCCERLVESGATVVIFTLIR
SCNRSVPCMEVITSSIQILLNLSKYHKTIEAVYSVENSVEILLDLLQRYREKAGDKVAEK
GGSIFTKACFLLALLLQERHRAAEVMNLPKVLERIRSIYRLTARKHKKDAERTFVKQKMN
ASISGSFFVQATPRRSRLLPKFAPDWVLRKDKLKDIVDPLRAIQMVAHTLSVEL
Download sequence
Identical sequences H2S1U2
ENSTRUP00000006363 ENSTRUP00000006363 31033.ENSTRUP00000006363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]