SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006393 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000006393
Domain Number - Region: 97-166
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00154
Family Myosin rod fragments 0.0058
Further Details:      
 
Domain Number - Region: 31-128
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006393   Gene: ENSTRUG00000002751   Transcript: ENSTRUT00000006433
Sequence length 340
Comment pep:novel scaffold:FUGU4:scaffold_324:64811:67086:-1 gene:ENSTRUG00000002751 transcript:ENSTRUT00000006433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPDTGARFGSLEEELEYWREQAARNNHSAEEAREELQEFQQMSRDYEVELETELKQCE
VRNRELLSANNRLKMELENYKEKYETQHSEAYRQISSLEGELAENTAIKDQLQKYIRELE
QVNDDLERTKRATIMSLEDFEQRMNQVIERNAFLESELDEKENLLESVQRLKDEARDLRQ
ELAVQQKQQVQDKTPPHSSALKELCSTPPAPLAVGGLPTPPLTPPDRRAEGRNPSSSSND
PICTPSRRGSLWRAPLTTTARISALSIVGELLRKVGNLESKLASCRDYINEQAASRRSRG
GGQGTPSGCGDSSESQPTNGLYNKGLMKRLDFGAGPKLLL
Download sequence
Identical sequences H2S1X2
ENSTRUP00000006393 31033.ENSTRUP00000006393 ENSTRUP00000006393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]