SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006685 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006685
Domain Number 1 Region: 13-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-43
Family G proteins 0.0000908
Further Details:      
 
Domain Number 2 Region: 172-270
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.54e-18
Family Chaperone J-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006685   Gene: ENSTRUG00000002873   Transcript: ENSTRUT00000006729
Sequence length 273
Comment pep:novel scaffold:FUGU4:scaffold_57:383688:385357:-1 gene:ENSTRUG00000002873 transcript:ENSTRUT00000006729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METNTPKRRDNKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQV
RDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVLLVYDVGLRESFDALDSWLGEMKQEMGS
QANMDSIVFIVCANKVDLTKRRVVDEGEGRLWAESRGFHYFETSAQSGEGINEMFQSFFS
SITDMCENGGKRPVTEVSAGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKL
AVLLHPDKCVAPGSEDAFKAVVNARTSLLKNIK
Download sequence
Identical sequences H2S2R3
ENSTRUP00000006685 ENSTRUP00000006685 XP_003966627.1.43653 31033.ENSTRUP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]