SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006687 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006687
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000538
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006687   Gene: ENSTRUG00000002875   Transcript: ENSTRUT00000006731
Sequence length 136
Comment pep:novel scaffold:FUGU4:scaffold_3939:5434:7440:1 gene:ENSTRUG00000002875 transcript:ENSTRUT00000006731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNQKLRELTEEEEEPPRPQTCSDVQPAQDAQCPSSRWYWKLVPIRYRKDKVQSKLTPTFP
LIHGVKDLSNGCAIASVLHYYCPVLLPLEDVCLKDTMSVADSVYNLQLIREFCESSLQSC
CPLAVEDLLYAPPPLH
Download sequence
Identical sequences H2S2R5
31033.ENSTRUP00000006687 ENSTRUP00000006687 ENSTRUP00000006687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]