SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007438 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007438
Domain Number 1 Region: 16-253
Classification Level Classification E-value
Superfamily L domain-like 4.42e-40
Family Internalin LRR domain 0.023
Further Details:      
 
Domain Number 2 Region: 551-659
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-24
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007438   Gene: ENSTRUG00000003171   Transcript: ENSTRUT00000007484
Sequence length 699
Comment pep:novel scaffold:FUGU4:scaffold_437:23592:38081:1 gene:ENSTRUG00000003171 transcript:ENSTRUT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLPPNRGLERALEEASSSGVLNLSSRKLKEFPQTAANHDLSDTVEADLSKNRLADFAADI
CHFVALETLNLYHNCIKTIPDSIISLQSLTSLNISRNQICSLPPCLCSLPLRVLNVSNNR
LDSLPETIGQLSNLMELDVSCNDISALPRQIGRLRALRELNVRRNALCVLPEDLAELPLV
TLDFSCNKVSTIPACYRKMKHLQSLQLDNNPLQSPPAQICIKGKVHIFKYLTMEACRSEK
LPVPLYLPVMKCLSQPTTGSVDKQRKQDSDSGVSSDNGDKRLSATEPSDEDSPSMPRTHA
TEEDGIRKAELLQHLFPLTGSLTPTDMNPVPLIEEDPTEALRDQGPESLHSGFVSYIKGR
AAGLDEPLRIEEELQWPAQQVVKYYKTKQKKLNSSGCLCRVSVKVDNVRESNHISMINIS
KRNILLYFSSGHMASCRLSQEIKSVHLSISPSSVTRTVMPESLHQRYSVTYQLDSSPGSG
PQSRCSPVFGLKQRSGENRILSLSRVRHIISCNFLLKSQEPRPPVFLGSHRSVESADPQF
TMRRKMEQLREELALMEQLRHSIESRLKLILPEDLGPFLMDGVVLCHLANHLHPCSVAGI
HVPSPAAPKLGMAKCRRNVENFLEACRKQGVPESSLCSPYDIIQCRLQPVCTTVQVLVSL
ETTPLDRKRKEAFNPSSCSLLHILCLVLLFLAYSWIELT
Download sequence
Identical sequences H2S4W6
ENSTRUP00000007438 ENSTRUP00000007438 31033.ENSTRUP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]