SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007537 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007537
Domain Number 1 Region: 15-49,124-201,240-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000199
Family C-terminal domain of adrenodoxin reductase-like 0.047
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000007537
Domain Number - Region: 18-114,230-281,431-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0617
Family FAD/NAD-linked reductases, N-terminal and central domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007537   Gene: ENSTRUG00000003218   Transcript: ENSTRUT00000007584
Sequence length 521
Comment pep:novel scaffold:FUGU4:scaffold_48:37123:39118:-1 gene:ENSTRUG00000003218 transcript:ENSTRUT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLEETTLPQEHPPTVPVVIIGNGPSGICLSYLLSGYKPYLDTATVHPNPILYRKLQDT
KHLPITEQDLEYLSEGLEGRSKNPVAVLFDTLLHPNADFGYEFPPVLQWRRDKQQHIPHL
VLGRATPGGAWHAMEGSMLTISLGIWMELPGVNYRDLTTGKRRDVTSDRATPEEMASYYR
NYVKIKGLQKNFVDNTYVTSVQKLSRGHEGKGLENGHSEQGDGEVGGRNEGFDRNGVECL
KNGGGALWEVRGYQKVQHGTHVPFSVFAENVVLATGASDSPVRLDAEGENLPFVFHSVSD
LALEIGRRKLDANSDPVLIVGAGLCAADAVLCACNSGVRVLHAFRRGVNDPDLIFKQLPK
TLYPEYHKVYNMMCSQTYANVSPSSDSNRPQDYTSFPEHCVLSFQADMKCLLQGSNSLKA
FKISVALVLIGTNPNLFFLKDQGQYLGQDPTKPVSCKQNPIDIHPYTFECTKEPGLFAMG
PLVGDNFVRFLKGGALGITSCLLKRLKKKGKIITGGGNDFI
Download sequence
Identical sequences H2S565
ENSTRUP00000007537 31033.ENSTRUP00000007537 ENSTRUP00000007537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]