SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007976 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007976
Domain Number 1 Region: 16-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-49
Family Nitrogenase iron protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007976   Gene: ENSTRUG00000003402   Transcript: ENSTRUT00000008024
Sequence length 232
Comment pep:novel scaffold:FUGU4:scaffold_419:158337:160396:-1 gene:ENSTRUG00000003402 transcript:ENSTRUT00000008024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSKVVQERQKQHMAKGLPKQKPIAGVKQVIVVASGKGGVGKSTTAVNLALGLLANDPAKS
VGLLDVDVFGPSIPKLMNLKGNPELSDNNLMIPLTNYGVPCMSMGFLVEEAAPIVWRGLM
VMSAIEKLLRQVEWGPLDYLVVDMPPGTGDVQLSISQNIPVSGAVIVSTPQDLALLDARR
GAEMFRKVNVPVLGLVQNMSVFQCPNCQHQTHIFGSEGARKLADSLGVQVLG
Download sequence
Identical sequences H2S6F4
ENSTRUP00000007976 ENSTRUP00000007976 31033.ENSTRUP00000007976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]