SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008491 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008491
Domain Number 1 Region: 1260-1393
Classification Level Classification E-value
Superfamily PRC-barrel domain 4.39e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000116
Further Details:      
 
Domain Number 2 Region: 208-305
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000223
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008491   Gene: ENSTRUG00000003622   Transcript: ENSTRUT00000008542
Sequence length 1403
Comment pep:novel scaffold:FUGU4:scaffold_15:16443:32400:1 gene:ENSTRUG00000003622 transcript:ENSTRUT00000008542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASDIKPLDLYDCTKAKICASVGWLLAKSYGCTENVPAELRDPFYCDQYEQEHLKPPVTRL
LQSSELYCRTYSLLLAQPETGEQPKDNAALVHLLSQKGVLSKDRDMAVTEADLQQKPIKM
GSHLAVIDALMAVAAVETVAAARTHTSADLLGGGCSWEDALLHWVNALNHRLRESNKEAQ
TDTSQSITEPESVQPSLRYRKDKMQSRQKPFFPVVNKVKDLSSGCAIAAVIHYYCPGLLR
LEEDVCMKESVSVEDSLYNLQFIREFCDSCLKNCCHLALEDMLYIPQELQINWLSFLAEL
LCWFEVKRPEFVQPLDTLGFFFHKLVPHQVTSVFKKPFLPISSNASGKIQPVFSTCSSIV
LCISCFQHYFPKLCLFFSRDTVLFICASVLCTSLHAFICLCVPLLCSGSLTQSTSMSHIE
GAGQTWSKKSLSRPLSAISFSIPFGLDSDVDIVMGDPVITRSVSSDHLNPASQNTNHMHF
TPPEDLSHLRVKSPSVNTPQRASWTTQSHGIPRVAEENGLAASETGELPTIEEALQIIHN
ESKLEPRLHPDGAPDGFYLHSPDDPASSRNNSKKLAPISSSAPTNSGMIHRPMGDSREPT
RTRNTSECSRDDDSVLRDGSVDSDASEDMPKAQSTPASGTRPVRGHSKEADSGVRMTSFA
ERKKKLTDSPKAVDSASPEMTTCAQKSEESSSNSPQPNDVSELGVRLEEKRRAIEAQKKR
IEAIFAKHRQRLGKSAFRQLKKEQFEDEVGEDGGDDILVSTSSTEEDLSRLSLDDKQAQM
EEEQWDQCEQRLSVEDDVNVKEELEPNNQGGDFNEKVLREKDSGTAGQKIAPLGDYNNAV
SKLTAALSSLQSDMQRLTEQQNHLLKKKPAASTTASTSPSPSHKTAAQTTPKSPHVQRRA
RSVPPKSPKHNQHSRPMDVKPPTYSRVITAPQNVDRIPHLRRTPVPTPSRTPVPPAIPTP
HYAADDTMSEIGSNDGNSVFNMDLEAGASHSISSKKERLTGGGCSSGAPSECSFESDVPA
GMLNGKRSSLIEISLSSLRGDGEEDDQVPEPFSDAMSDRTDPDMKGGVGFFFREDKERPE
DEMAQRRAAFLEKQQKRAEELKRRKLEQEKEKESNEDRPRTPGTPPASVDGTPQRRGDFT
RQEYERRHQLKVMEDLDKVLRQKPTTVRGVKKQRPKTVFRDDSSLSHSPVKGLIGTRLNK
VYSHSTMNLSSMANDSGGLTIRKSPSRSHSPSRFMSPRRMSGQNGEKDWENGSTISSASI
PEYTGPKLYKEPSFKSNKFIIHNAITRCCLAGKVNEPQKNKIVEEMEKSAANHFLILFRD
VSCQFRAVYTMNPETEEMVRLTGIGPRIILPEMVESIYKYSSDRKQFTVIPSKTMSMSVD
AFTIPSHFWQKRPGTPKKLGTPK
Download sequence
Identical sequences H2S7W8
ENSTRUP00000008491 ENSTRUP00000008491 31033.ENSTRUP00000008491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]