SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008559 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008559
Domain Number 1 Region: 13-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.45e-88
Family PAPS sulfotransferase 0.0000000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008559   Gene: ENSTRUG00000003656   Transcript: ENSTRUT00000008610
Sequence length 300
Comment pep:novel scaffold:FUGU4:scaffold_2801:3155:9993:-1 gene:ENSTRUG00000003656 transcript:ENSTRUT00000008610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFIIIFSTRETPVRGKLFDLHGVPMIECFASNWEKVQSFQARPDDILIATYPKAGTTWVS
YILDLLYFGQTSPERQTSIPIYERVPFLESAFPFMDTGTELLEKLPTSPRIIKTHFPVQF
VPKSFWKQNCKIVYIARNAKDNVVSYFHFDRMNHIQPEPGDWDTFLHRFMMGKVTFGSWY
DHVKGWWEKKQTYSNIHYVFYEDLIEDPGQELDRLCSFLGLSPSAHEKESVLTGAKFDNM
KKNKMTNYSTVPIMDQGVSPFMRKGKVADWKXFTEAQNKEFDQDYKQKMKNSTLRFRDEI
Download sequence
Identical sequences H2S834
ENSTRUP00000008559 31033.ENSTRUP00000008559 ENSTRUP00000008559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]