SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008717 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008717
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-85
Family Calponin-homology domain, CH-domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 2600-2724,2768-2829
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-26
Family Plakin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 4459-4601
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-25
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 238-354
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-23
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 5 Region: 4954-5029
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.32e-23
Family GAS2 domain 0.00045
Further Details:      
 
Domain Number 6 Region: 4035-4165
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 1121-1301
Classification Level Classification E-value
Superfamily Spectrin repeat 1.76e-19
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 8 Region: 3788-3949
Classification Level Classification E-value
Superfamily Spectrin repeat 3.54e-19
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 582-684
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 10 Region: 4381-4495
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 4250-4384
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 12 Region: 2842-2960
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000327
Family Plakin repeat 0.00079
Further Details:      
 
Domain Number 13 Region: 4853-4940
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000183
Family Polcalcin 0.078
Further Details:      
 
Domain Number 14 Region: 3589-3727
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000612
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 15 Region: 4163-4275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000012
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 16 Region: 4598-4711
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000518
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 17 Region: 4661-4845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000666
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 18 Region: 488-580
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000072
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 19 Region: 3283-3447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000903
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 20 Region: 3943-4053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2465-2494,2535-2567
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000235
Family Plakin repeat 0.0043
Further Details:      
 
Domain Number 22 Region: 3520-3619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000835
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 23 Region: 3128-3179,3259-3309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00009
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008717
Domain Number - Region: 689-771
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00192
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 2155-2257
Classification Level Classification E-value
Superfamily AGR C 984p-like 0.00824
Family AGR C 984p-like 0.022
Further Details:      
 
Domain Number - Region: 763-819
Classification Level Classification E-value
Superfamily SH3-domain 0.0364
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008717   Gene: ENSTRUG00000003715   Transcript: ENSTRUT00000008768
Sequence length 5076
Comment pep:novel scaffold:FUGU4:scaffold_456:72185:122791:1 gene:ENSTRUG00000003715 transcript:ENSTRUT00000008768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADERDRVQKKTFTKWVNKHLIKADRRVDDLYEDLRDGHNLISLLEVLSGEKLPREKGHMR
FHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLILGLIWTIILHFQISDIQVNGQSE
DMSAKEKLLLWSQRISDGYQNIRCENFSTSWRDGKLFNAVIHKHYPRLIDMGRVYHQTNL
ENLEQAFDVAERDLGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRNAVQYGAKASEL
ELRWQEYYELVTFLLQWIRQHIVIFGEKKFPTSYEEIELLWRQFLKFKETELPVREGEKN
HSKAIYQSFESAVHAGQVKVPPGYHPIDVEKEWGHLHVAMLERERLLRIEFERLERLQRI
VSKIQMESELCDGELSRLESLLQTDIRLLNAGKPAQHAAEVERELDKADNIIRLFFNDVQ
ILKDGRHPQADQMYRRVYRLHERLVNLRSDYNLRLKATRTTTQTTLTQNIQQTTMKVRPE
MDDVTLRYVQDLLAWVEENQHRIDEAQWGSDLPSVESQLGSHRGLHHTVEDFRSKIERAK
ADETQLSPVSKGAYREYLGKLDLQYGRLLNSSKSRLRNLDSLHAFVSAATKELMWLNDKE
EEEVNYDWSDRNTNMAAKKDNYSGLMRELELREKKINDIQALGDKLVRDGHPGKQTVEAF
TAALQTQWSWILQLCCCIEAHLKENTAYYQFFADVKEAQDKIKKMQESIKKKYSCDRSTT
TTRLEDLLHDAAEEKEQLNEFKTIVTNLNKRAKSVIQLKPRNPTTPIKGKLPVQAVCDFK
QQEITVHKGDECALLNNSQPFKWKVLNRSGHEATVPSVCFLVPPINKEAVDSVSSLDAGH
QQMISMWQTLHINVKSLLSWQYFMKDFTQIHSWNINMLKNMKPEEYRLIMRNLELHYQDY
MRDSQNSQLFGPDDRMQVEEDYTKATQHFDSLLHTMEKGQQDETLCKNYISEVKDLRLRI
EDCEAGTVARIRKPVLKEPLRECVQKTSEQQKVQVELEGLKKDLNKVSVKSQEVLASPQP
SASTPVLRSELDLTVQKMDHAYMLSSVYLDKLKTVEMVIRNTQGAEGVLKQYEDCLREVH
SVPSDIKQVETYRTKLKKMRTEAEGEQPIFDSLEEELKKATTVSNKMSRVHSDRDVELDH
YRQQLSNLQDRWKAVFTQIDLRQRELEQLGRQLRQYRDSYDWLIRWIADAKQRQEKIQAV
PISDIKTLKEQLAQEKKLLEEIEDNKDKVDDCQKYAKAYIDTIKDYELQLVAYNAQVEPL
VSPVKKTKLDSASDNIIQEYVTLRTQYSELMTLTSQYIKFITDSQRRLEDDEKAAEKLKE
EEQRKMAKMQAELDKQKQLAEAHAKAIAKAEKEAQELKLRMQEEVCRRETAVVDAEKQKQ
NIQLELYELKKLSEEQIKDKKSELKQLRDKAAEAERLRQAAKEEAEKLRKQVNEETQKKR
IAEEELICKAEAEKEASRQKQKALEDLENLKRQAEEAERQVKQAEFEKERQLKVAHQAAQ
KSAAAELQSKHLSFVEKTSKLEESLKQEHGAVLQLQEEATYLKRQQEDAENAREEAEKEL
EKWRQKANEALRLRLQAEEEAHQKSLAQKEAEKQKEDAEREAKKRAKAEDSALKQKEMAE
NELERQRKIAESTAQQRLSAEQELIRLRADFDNAEQQRSLLDDELYRLKNEVIDAQQQRK
QLEDELAKVRSEMDLLGQLKSKAEKESMSNTEKSKQLLETEAAKMRDLAEEASKLRAIAE
EAKRQRQIAEEETARQRAEAERILKEKLAAISDATRLKTEAEIALKEKEAENERLRRQAE
DEAYQRKALEDQANQHKQAIEEKIIQLKKSSEAEMERQRAIVDDTLKQRRVVEEEIRIIK
LNFEKASSGKLDLELELNKLKNIAEETQQSKLRAEDEAEKLRKLALEEEKKRRDAEDKVK
KIAAAEEEAARQCKVAQEELERLRKKAEEAKKQKDEAEQEAETQIVMAQQAAQKCSAAEQ
QVQSVLAQQKEDTVVQKKLKDDYEKAKKLAKEAEAARERAEREAALLRNQAEEAERQKAA
AEEEAANQAKAQEDAERLRKEAEFEAAKRAQAEAAALKQKQLADAEMVKHKKLAEQTLKQ
KFQVEQELTKVKLQLDETDNQKAVLDEELQRLKDEVDDAVKQKGQKFLAKEADNMKQLAE
DAARLSLEAREAARMRQIAEDDLSQQRALADKMLKEKMQAIQEASRLKAEAEMLQRQNDL
AQEQTQKLLEDKQLMQQRLDEETEEYQKSLEAERKRQMEITAEAEKLKLQVSQLSEAQAK
AQEEAKKFKKQADSIASRLHETEMATKEKVTEVHKLELARMNTSKEADDLRTAIAELEKE
KARLKLEAEELQNKSKELSETSVELSCHTYPMASLETFLSEKQMLLEKERLIEEEKKKLE
NQFEEEVKKAKALQDEQERQRQQMEDEKKKLQATMNAALSKQKEAEKEMENKQKEMKELE
EKRLEQKYTVDEAVKAGVVGPELHEKLLSAERAVTDKKTGLPLLPLSDEAIKQSKEALAY
NEAQTKEVMTQATVELDSGPFKGRKMTIWEIINSEYFTEEQRHDLLRQFRSGKITIEKII
KIVITVVNEKEAKKQEQFNFYGLRGPVPASCLYDSKIIDKPTFELLQKGKTTPKQVSENP
DVNKYLRGSESIAGIYVAPTKEKMSVYQAMKKKLLRHNTDSLKTNAKEIQKQGLADKSLN
LWDVMNSNLLPDQERQKLMDEYRSGKITKERMIIIIIEIMEQREIIKNESPFTYQTIRRR
ITIEELYNARIIDLETYNLIKEDIALQRGYINKETNERLTDSVQGFVDPVTEENLSYAQL
LKRCKLDGGLRLLSLGDKRLMFKGLRKQITMEELIRSQIIDQQTVTELNEGLLSVEEVSS
RLSKYLEGTSCISGVFLESTKAYRRGLIDQQTYLELAEQECEWEELTMVPSSLLSLTEGQ
EDSGMIEPDVDSRVSLDDSIRFLRNSVHVLRVDIGGNVCKIMTTAERSADVFCFKRHSCA
VNLKTGEKNEENKRFRWEEEAKEAGKRESLQQEQGGIYPAAVDSLRSDRVRYQLLRNISV
QSEMQLALLSLAMESRNGPRQLSLNMLSDGLVRSSPRVKMVEGWSCSPSIMNASWQCLFK
GPTPALALKDASTDSETFLHSLDALLAWVCEIEELKANQKPPSSEVKVVKAQLQEQKEAV
LRSGRRSKGPIQLSSVLNGVFTAEMGLQKKSKQSYDIYSYSNVKALTIKCLAKMSILTVL
LTFIFTYCKCKPALFQLLQRLLTDRRRSMDTIMLDGPQPAVDGEEEGEQTKLKLSTLKQK
WEALQLDAEQSLFVEVLHAMQISPKDISVVRRRAALEHILPRAQLFQEGVDSLQQWFMSV
EQTLAQLRNAERVMLHLPEATDRAKAVVEEIQFKSADLGETQKSGHDLMEALSEEEAQQV
QEKMDALRIRFSVLNLSSLDVLQRLDQALEASSRCTSSQEDLHLWLGRIERELLVAAGAQ
THTGDAVLCSAERQRVVFFKLSGGLSNFDNSFQRNLFLEQAVVKEMSWFKDTAQSLEKLK
IIHLEPQVIAEQLYEQKILAVEILQHRFNIEKMVKIAEILLTYSDEGEAGSLQAPLEALQ
EQCNTTSATNSHVVLQLEHAQSLLQQFSEGLTEVSPWLKETQTLIGQLSLSTISYEAFRE
QQDLLQGLRESIAEHRPLIARLCSLAKRLSELNPTQGEDFCRKATEAEEQHGAIRDRARQ
TAKLLEESLPRFTQLNERMSVLRGSLERLHSHLKAPSSLQGLTPRIQEQLQDNKHSLDEL
LKMELGLSSIKTHAEELLANTQAAGDDFAISAIQEQVSSLTQMWDEAHVQAQDRERWLLK
LLDLSVKFWSDVSDVTVALTDAQQAVMDLNASQTDSETIRQSLESMQTLREDIDSLQGDL
DTLGVVGMELMSSCGDTDKPDVTKCLDELYCTWNNLSKMWSECHKKLEESLQMALNYQDT
MQGLFEWLKSAELRSTEEFVIENDLESVKGQLYDLKEFKRELYQKKIEIESLNHRFVCRL
SPGSERPGSVSPLCDFRQRWDSLESETVGRQQHQLECALLGLGQFQNTLDELHTWLSRTA
EQLEGIRPISIDLQACEIELAKHKVLRNDVMSHVRTMESVNQAGGGLLEVGSGDCPNGLQ
ARLEELNDSWEFVRCETERKQLELENRLSQVQDVTMEIQDLLQWLDNTDLRLSSSKTMWG
MPDSASERLNAHLELCNEMDSKFHTYTDVRNAINRMLEISNVVRGSSTEHSLSMLEQKWA
SVYSKVQERKAKLAEGLNLAKEFHSNVQELLLKMCKCEESIGLLPAPSFVLDTVCSQLQD
HRKLASEVSDYGDVRGAVEDRARRLSELSRKEDSDVIHNLMMIVQDRHKKLQLRVAERGR
TLEEVKKNAKQFNESWRLMMDWLMEVERTLDTHKEIAVSHEEIKQQLTEQKGFQKLLRAK
RPMYAASLKSGRSLHERAQTSHDRQHLENLLAELKDTWDTISGKSMERQHKLEEALLFSG
RFTDALQALNDWLYRAEPQLAEDVPVSGDKDMVHNLMDKHKAFQKELGKRAGCIRTLKHS
VKDLTRGSTADAHWLQEQMDELEVRWEAVCKLSVSKQDRLEAALLQAEKFDGHVHSFMDC
LTEVERGLKYGVMPEEEEPLLVFSKEHKELMVALQAQAANLHNIQCLGEEILAACHPDSI
ITIKSWISVTKTRYEEVQTWGQQQSQKIESSLAALEAEKEEIQRLLDWISSADEALCLRD
QDTLAETTEQNQELIEQHTVFMEELNKKFPDVEAATKSCRHKSVPKQVSPGKRPLTKRRS
TLKMQPAVPIPLEHLDPHTPELSQLVSQWQKLWLLAVARQKCLEQHQQALKEMEEFANFD
FNIWRKRYNQWISHLKSRILDVFRSIDRDQDGRISHKEFVDYVLASKFPTNSLEMNAVAN
IFDMNNDGYIDYYEFVSALHPSRDPYRKTLDADQINEEVSRQVSQCNCPKRFQVEQISAN
RYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRVKGRTNLKIKEKYLSPTG
SSSKGLAVSRSNSSLSLYSSASAPTSPMTRKVRQNH
Download sequence
Identical sequences H2S8J2
31033.ENSTRUP00000008717 ENSTRUP00000008717 ENSTRUP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]