SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008835 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008835
Domain Number 1 Region: 3857-4090
Classification Level Classification E-value
Superfamily Plakin repeat 5.89e-80
Family Plakin repeat 0.0000000359
Further Details:      
 
Domain Number 2 Region: 3281-3518
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-76
Family Plakin repeat 0.000000429
Further Details:      
 
Domain Number 3 Region: 2625-2862
Classification Level Classification E-value
Superfamily Plakin repeat 4.71e-74
Family Plakin repeat 0.000000699
Further Details:      
 
Domain Number 4 Region: 2951-3189
Classification Level Classification E-value
Superfamily Plakin repeat 1.26e-73
Family Plakin repeat 0.000000247
Further Details:      
 
Domain Number 5 Region: 3616-3850
Classification Level Classification E-value
Superfamily Plakin repeat 4.19e-73
Family Plakin repeat 0.000000551
Further Details:      
 
Domain Number 6 Region: 4166-4207,4243-4438
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-67
Family Plakin repeat 0.000000347
Further Details:      
 
Domain Number 7 Region: 4-76,125-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-56
Family Calponin-homology domain, CH-domain 0.00000295
Further Details:      
 
Domain Number 8 Region: 247-362
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-25
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 560-697
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 1136-1315
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000199
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 4113-4161
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000246
Family Plakin repeat 0.0077
Further Details:      
 
Domain Number 12 Region: 703-785
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000192
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008835
Domain Number - Region: 1018-1136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000417
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 500-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000511
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008835   Gene: ENSTRUG00000003762   Transcript: ENSTRUT00000008886
Sequence length 4503
Comment pep:novel scaffold:FUGU4:scaffold_452:101571:134801:1 gene:ENSTRUG00000003762 transcript:ENSTRUT00000008886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLTDERDRVQKKTFTKWVNKHLVKAQRHVTDLYEDLRDGHNLISLLEVLSGETLPREK
GRMRFHKLQEEFACEMMSCAVTHHHRTDDNRTDDRTGLGLGKLFLMLYWGLDHISPQISD
IQVNGQSDDMTAKEKLLLWSQRMVEGNQGLRCDNFTNSWRDGRLFNAIIHKLRPNLIDMG
LVYRQSNQENLEQAFTVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDVMPRVPDV
QDGVKANELELRWHEYYELVTMLLQWIRHHVLVFEERKFPTSYEEIEVLWHQFLKFKETE
LPAKEADKNRSKNIYKSLEGAVQAGHLKIPPAYHPIDVEKEWGRLHVAILDRERLLRTEF
ERMERLQRVVSKVQMESGVCEEQLSQVEALLQTDVRMLSSGKPARHTTEMEADLDKAEAR
IRLLFNDVQLLKDGRHLQAEQMYRRVYRLHERLVNLRSEYNLRIKSGVTPTQIPLSHMLT
SQVLQQAAPRGRPELDEVTLRYIQDLLSWLEENQRRVDEGAWGSDLPAVESQLGGHRGLH
QCVEEFHTKMERARADESQISPGRKAAYGEHLGRLEQMYRKLLNQSKARLHHLEQLHAFV
MAATKELMWLNDKEEEEVNYDWSERNTNMAAKKDNYSGLMRELELREKKMNSVQATGDQL
LRDGHPARKTIEAFTAALQTQWSWILQLCCCIETHLKQNTAYFQFFSDVKEAEEKMKKMQ
EAMKRKYSCDRSITVTRLEDLLQDAADEKEQLKELRAHLDGLNHRAQTIIQLKPRNPATA
IRSKLPIQAVCDFKQVEITVHRGDECALLNNSQPFKWRVLNDKGSEASVPSICFLVSPTN
KEAMSSVAGLDGTLQKLQMMWHSMFVDMKSLLSWQYLMRDIQTIRTWSITMFKTLRVEEY
QLALRNLEQHYQDFLRDSQDSQMFGAEDRMQVESSYNRASQHYNTMVGSAEQGEQDELRC
KSFLTQTRDLRLRLEGCENRTVLRFRQPVGEEPLKACAGKTAEQKKVQVELDGLKKELNC
LTEKVEEILASPQQASSSPVLRSELDVTLKKMDHVHGLSSIYLEKLKSMDVVIRNTNEAK
DTLKNYENRLRDVNKVPADEKELENHRKMLKAMFAEAEADQAVFDRLQADLKQATAINDR
MTRLHGEHDAQLEQHRLQVDVLLERWQAVFAQLDLRQRELNLLGRHMNIYRGSYDWLICW
LREARERQERIQALPVGDGKALHDQLVEEKKLLEEIKRNKDNIENCQQNAKAYIDSVKDY
ELQLLMYKALEDPTASPLKKPKIEGASDNIIQEYVNLRTHYSELTTLTNQYIKFITETRH
RLDDEEKASEKLKEEEKRRMAEIQAELDQQKQLAEAQAKSAARAEQQAEELKLKMKEEAN
KRQDVAVDAEKQKQKIQQELVNLKRLSEQEIKSKNKQLEEALISRTKIEEEIHIIKLQLE
TTIKQKVTADAELQALRDKADQAEKLRKNAQDEAERLRKQVAEETQKKKHAEEELKCKSE
AEKAAAKQKQKAMEDLQKFKMQAEEAERRMKQAEEEKSRQIKLVEEVAQKSTVTHLQTQS
MLYTDKTTKLEESLKKEQGTVLQLQEEAEKLRKQQEEANRAREQAEKELETWRHKANEAL
RLRLQAEEEAQNKCQAQEEAERQKAEAERDAKNRARAEDAALKLKENAEKELERQRTFAE
EIAQQKLSAEQECIRLKSAFEHADQQRSLLDNELHRLKNEVTAAETQRKELEGELGKVRS
EMDALLQMKVEAEKQTMSTAEKSKQLLETEALRMKQLAEDAARLRAVAEEATKQRKAAEE
EAARQRAEAEKMLKEKLAAINEAARLKAEVEIALKAKEAENEKLKRKAEDEAYQRKLLED
QAAQYKQDIEEKLTAVKSSSDAELQRQKNVLEETLRQKNLVEEEIYIIKINLEKASKGKS
ELEVELKKLKDIAEESQRSKLKAEEEAEKMKKLATEEEKKRKESEERVKIITGAEKEASR
QWKAAQEEVERLKKKAEEANKDKDKATQEAEEQALQAQEAARKCGIAEQKLNDILSKNRQ
DILAEEKLKEEFENAKKCAQEAQKAKEAAEREAASLRQKAEEAEKQRKAAENEAAKQAKA
QKEAEMLKKEAEVEVSKRTAAQATALKQQKQADEEMAKQKQQAEEALKQKSLVEKELTVV
KLQLEKTEKQMDVLDEELQRVKGEVNDAIKQKAQVEEELSKVKTEMSELLKLKLKIEEEN
RHLLQKDKDKMQQLLAEEAAKMKLLAEDAARLSVEATELARQRQMAESDLAEQRALSEKM
LKEKMQVSQEATKLKAEAEELQKQRNQAQEMANKLQKDKQKIQERLDQETEAFQKSLEAE
QKRQLEISAETEALKLKVKELTDSNAKAEEEVKKVKRQSDEVKVKLQAIEKQNKEIVLQK
SETQTLQSSREAESLRKAVADLEKEREQLKKEAEELQKKSQEVAKGQQEEIKQQKTILQQ
SFLNEKELLLKREKAVEDEKKKLQRQLQEEQNKAKALQDEQKCQLKMMEEEKSKLQAVLD
EAVKKQKEAEAEMTNRQKEIQVLEKKMTKQEKLHGEENSKLIEKLKSIDDASKQAAAKKK
EIQVQTDDISDEQVVSVKAVKTTKKGFNGSVEVDAAKMAEDSLAFDGIREKVPAARLHDI
GVLTKKEFDKLKKGKLSVEDLKKTDKIKTCLKGQNCVAGVLTPSKDITSIYQAMKEKKIS
PSTATVLLEAQAASGYIVDPVGNKLLSVDEAVKAGLIGPELHSRMLAAEQAATGFKDPYT
GAKISVFEAMKKGLVEKDQATKFLDVQLATGGIIDPINSHRTPIQIAYQQGQFDPDMNKK
LCEPSDDYKLFTDPSTQELLVYKNLLEKCTKDSETGLLLLPVCEQAAEPENIYTDQETKE
VLSKSTLNVPFGRFKGKCVTIWEVINSEYFTEDQRRELIRQYKTGKITVEKIIKIVITVV
EDKEKNKENVFIGLKAPVTASELLESKVINKDLFNKLSNSKITVKEISEMDTVKKALQGT
PSIAGVYDQSTKEKMSLYQAMKKEILSPETAINLLEAQAATGFIIDPIKNERVPVKNAVT
SGLVGPELHEQLLSAERAVSGYNDPFTGKIVSTFEAMNKGLIKRDRGIRLLEAQLATGGI
IDPIKYRIPHEIACKRGYFDEEIGKTLANNTPETQVFHDPNSQLDLTYAQLLKKCMTDKD
TGLPLLSLSKKETKPKEEKHITEAETKEALNQATMELEYGPFKGQKVTIWEIINSEYVTE
EQRIEMIRQYRLGHVTIEKLIKIVITMVDEKRDKPKEDICFEGLRALVPAKSLLDSKIID
AATFDKLQKGEKTPQDVSEADKVRRYLQGTDRVDGIIMTDSNEKISIYQAMKDQILQQNT
GLALLQVQAGTGSIVDPVKNLKYSVDDAVKNGVVGPELHEKLLSAEKAVTGYKDPYTGNK
ISLFQAMDKDLVLSKHATPLLEAQFSTGGIIDPINSHRVPNDVAIQRGIFSKQLSQAFCD
PTDDIKSFINPNTNERVTYQQLVEKCVRDAPTGLCFLALPVAECSGPAEKSYQYTEEEAQ
TDLAQSQIDIPQTTGKPVTIWEVLNSNMLPEAESSRLLEQYRLGHITKERMVIIIIEIIG
QREILKSQQNMSCDIIRRKVGIEELYSARIIDLHIYNLLKEGKLTIREVMERPSVKQYLF
GTGCIAGIVSDSPPRVSIYQAMKNGQIKPEVALNLLEAQAATGFMIDPVKDELLTVDESV
RKGIVGPELHDKLLSAERAVTGYKDPYSGRVISLFQAMKKELVPEDYALRLLEAQIATGG
IMDPEYNFHLPIDVAMQRGYINSETLDKLSDATGDFRGYIDPTSDEKQSYAQLLKRCRVD
KDTCLQLLSLADRRLLFRGLRKQITVDELLRSQIINQKTYNELSDGTISVEEVSRNLKKY
LEGTSCISGVYVESSKERLSIYQAMKRTDRPGTAFELLEAQAATGYVIDPIKNLKLNVSE
AVKMGVVGPEFKDKLHSAERAVTGYRDPYSSKVISLFQAMKKGLILKDHGIRLLEAQIAT
GGIIDPEESHRLPVETAYVRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCI
TDPETGLALLLLKEKKREKKTSSKSSVRKRRVVIVDPETGKEMSVYEAYQKGLIDQQTYL
ELADQECEWEEITRTSSDGVVKSVIIDRRSGRQYDIDDAISKGLIDKSALDQYRAGTLPI
TEFADMLAGNMTGSRSRSSSFGSSSSYAMSPIPTIQAPAATWIDPTEETGPVAGILDTET
LEKVSITEAIHRNLVDNITGQRLLEAQACTGGIIDPNTGEKFTLTDAMNKGLVDKIMMDR
ISLAQKAYNGFEDPRTKIKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDAPSRVSI
DDAVKRGTIDARSAQKLRDVGAHSKYLTCPKTKMKISYKDAMERSMVEEGTGLRLLEASS
QSSKGLYSPYSISGTGSASGSRSGSRSGSRSGSRRGSFDATGSSFTTTFSSTSYTSPAYG
RRY
Download sequence
Identical sequences H2S8V9
ENSTRUP00000008835 ENSTRUP00000008835 31033.ENSTRUP00000008835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]