SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008866 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008866
Domain Number 1 Region: 29-474
Classification Level Classification E-value
Superfamily Sema domain 3.27e-118
Family Sema domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 1577-1704,1889-2075
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.73e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1053-1149
Classification Level Classification E-value
Superfamily E set domains 2.22e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 1146-1237
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000293
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 477-528
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000249
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1236-1354
Classification Level Classification E-value
Superfamily E set domains 0.0000000467
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008866
Domain Number - Region: 1365-1423
Classification Level Classification E-value
Superfamily E set domains 0.00132
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 
Domain Number - Region: 629-664
Classification Level Classification E-value
Superfamily Plexin repeat 0.00968
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008866   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008917
Sequence length 2108
Comment pep:novel scaffold:FUGU4:scaffold_301:104044:127319:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMLLSILLLAISFSVSVVRGSSPLSLYPTFVQNNTQFEHLALHPDPSIGWIYVGAQDHLF
QLDRFLQPEYQTDTGPIIDSRECLPPVTESNCPQARITNNHNKLLLVDPYSMELITCGSV
NQGICQKRSLDSVNNVFFSTERPVDTQYVAANHPNVSTVGLVVRPKPDRKPLMFVGRGYT
SSHPPISTRNLAQEPVFSYEETAKLAVAGRLSEYDHHFVSSFAHRQHVYFFFYRRDLKSM
SREYRTYVSRICLDDQAYYSYVEVPLTCRSMAGKVYNLLQAAQLGISKDGVVDSETLFGV
FSTHSTSSFPPSEDSALCMFNLEDVDRRIISTRDLCYTQMGREAGVEVAYIEYEVKSNCA
NLPENTLETYPCGSDHTPSPMASRVPVEAETILNSPSARLTAVAVSVRAAHTIAFLGDSR
GNLHKVFLGPNGEVEEYSVISVQKNAAISSDLILDQNEEHLFIMTPNMLQKRPVAECQQH
PDCQSCLLAHDPYCGWCVLDGRCVLQSQCSRGQRPGEWLWSFDMDQQCLQVQELNPSNLS
REESQTVSLAVPGLPLDEGESYSCIFEDVHSPAVVSRDRVSCQSPNPGSLPVVPLGQDYI
TVSLSLRFGSVTITVRDFTFYDCTAVKQLSGRTPCRGCVRSRWGCNWCVQQHVCTHKPTC
EDGTIIYNQHFKLPTSAPHTTKPVSPNPVTMATVALTTTTTRITRGIEASPAVTSSATEA
APNTVVLSEALDPVMPLVTPPPDPDSSTLNVVTAWSPTTPHEAKGALSTVETQTSPSQVV
PLHTPFPVGEPPESDPLLNLTKPPSLGPSQESQPETGRPYHEVHLWTTEDMDVPTESALQ
PGNDSSTFSAATVLSGDGEIDHTPQSYPHMLDPDLDLDSQYIPANGFLPGDEGSYVSWGS
SACPCLEKVQGSSLLPVGVERKILTGPNLHLYQDVELDYECVLVIEGHTVVVDAFVESDD
MNPSSFDITCQLHKYQYSSVGNQYNAMVYVKRRNTFHLDSSPDLFVTLYNCSVGRSDCSR
CHTADQKYGCVWCGGAQASCLYSQSCSEPVQHTCPAPVIHSIEPLSGLLEGGTMVTISGS
NLGQKVEDILHSVSVAGVPCSVISSLYEISSRIVCRTTASGGKNSGQVSVKVSGGELGLS
TEMFTFQDPFVMSVSPHRGPKAGGTILTIIGRNLLTGRPSDLTVTVGRVSCHIMEPYSSS
SLQCVTGSSNLTGQYRVTLHYSSGLRHLHSSTYRYTHNPNITLAMPTKSFLRGGRLIYVS
GHNLDVVQEPRMVVTSSSSQLMQQRGKRMLPDHPECPENFSERCDVNSSSLMLCRSPSVD
SSVMGSKMTVEFLLDNLRFNLSSLTPQGFTYEPNPDLRPLNQQDPMKAYRYNPGSFIQLE
GENLDLAITKDEVVVLIGQGVCAVKTLTRNHLYCEPPPKQPPPISNGRKREGFDSLPEFT
VQMGNLNFSLGKVQYDTIGLSTFPLEAQIGVGVGASIVALIVLLPLNRRKSKQAMKDYKK
VQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFFPGHRESP
LRRDLDVQECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVA
LHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFLRDSAG
ESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNVLVQGAGVSEYQ
PLPTKVLDCDTITQVKEKLLDQVYKGTSFSHRPHSDSLDLEWRSGVAGHLILSDEDLTSV
VQGSWKRLNTLQHYKQVPEGATVALVARHTKHIHDNHDYMAGEKTPMLEDADEGGVRPWH
LVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVILSTCRPV
PLAVKYFFDLLDEQAGQHGISDSDTIHIWKTNSLPLRFWINIIKNPQFIFDVQASDHVDA
VLSVISQTFMDSCTIAEHKLGRDSPINKLLYARDIPRYKQMVERYYSDIRQTVSASDQEM
NSALAELSRNYSGELNYLVALHELYKYINKYYDQIITALEEDSTAQKMQLGYRLQQIAAA
VENKVTDL
Download sequence
Identical sequences H2S8Z0
ENSTRUP00000008866 ENSTRUP00000008866 31033.ENSTRUP00000008866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]