SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009440 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009440
Domain Number 1 Region: 484-773
Classification Level Classification E-value
Superfamily Folate-binding domain 4.71e-85
Family Aminomethyltransferase folate-binding domain 0.0000276
Further Details:      
 
Domain Number 2 Region: 58-271,382-451
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-57
Family FAD-linked reductases, N-terminal domain 0.00057
Further Details:      
 
Domain Number 3 Region: 272-381
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.08e-27
Family L-aminoacid/polyamine oxidase 0.01
Further Details:      
 
Domain Number 4 Region: 775-862
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.13e-19
Family Aminomethyltransferase beta-barrel domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009440   Gene: ENSTRUG00000003979   Transcript: ENSTRUT00000009495
Sequence length 869
Comment pep:novel scaffold:FUGU4:scaffold_337:27519:34141:-1 gene:ENSTRUG00000003979 transcript:ENSTRUT00000009495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMSRILQLVSAHLRKDLAACHGAIPGSVRTISCTARTHAEESDAASVLGKRWKDTAETVI
IGGGCVGASVAYHLAKSGMKDVVLLEKSDLTAGSTWHAAGLTTYYHPGINLKKVHYDSLK
LYERLEAETGQAVGLHQPGSVRIASSPARVDEMKYQMTRTHWHVTEQYLIGPEKVKELFP
LLNMDKVLAGLYTPGDGHIDPYSLTMALAAGARMYGAQIYNPAPVTGLSPRADGKWDVQT
PHGTILANRIVNATGFWAREVGKMIGFDHPTIPVHHQYVVTATVPEVKALKKELPVIRDL
EGSYYLRQERDGLLFGPYEKMEKMKLQDSWVTDGVPPGFGKELFESDLDRIMEHVEMAME
MVPVLKTADIVNIVSGPITYTPDLLPMVGPHQGVRNYWTAIGFGYGVIHAGGIGKFLSDW
IRNGEPPYDLIECDPNRYSKWVDVPFLCAKARESYGFNNVVGYPKEERFAGRPTYRQSGV
YQLLKDKGSMGFHAGWEQPHWFYKPGDETGYKPSFRRTNWFKPVGREYQLVMEKVGVIDL
TPFAKFIVKGKDSNRLLDRLVANTLPKVGVTNISHMLTPAGKVFAELTITQLTPGEFLLI
TGSGSEGHDLSWIETEAQDGGYEVDISNVTEDIGVLGIAGPNSRKVLQKLTNEDLSDAGF
KFLQCKSIQLAGIPVRAIRISYTGELGWELYIDQKNMAAVYQAMMEAGKDEGIDNFGTYA
MSSLRLEKGFRGWGAEMNSDTNPLEAGLDYFIKLNKPADFIGKAALQEIKAKGLKRKLSY
ITLDTDNIDPEGNETVWHNGKVVGNTTSGAYSYGTQQSLAFAYLPLELCSVGQKVEVELL
GRKYPAMVVQEPLVLTEPTRTRLQKKAKG
Download sequence
Identical sequences H2SAL4
ENSTRUP00000009440 ENSTRUP00000009440 31033.ENSTRUP00000009440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]