SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010095 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010095
Domain Number 1 Region: 27-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-90
Family Calponin-homology domain, CH-domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 296-415
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-32
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 2392-2511
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-31
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 4 Region: 600-738
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 808-949
Classification Level Classification E-value
Superfamily Spectrin repeat 2.7e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 1222-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-23
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 7 Region: 1696-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-22
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 8 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-21
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 9 Region: 1589-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 10 Region: 1750-1903
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 906-1054
Classification Level Classification E-value
Superfamily Spectrin repeat 1.35e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 12 Region: 1451-1585
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-19
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 1036-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-19
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 14 Region: 528-636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-18
Family Spectrin repeat 0.00081
Further Details:      
 
Domain Number 15 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 16 Region: 741-843
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000268
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 17 Region: 1346-1441
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000406
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 18 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000389
Family Spectrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010095   Gene: ENSTRUG00000004257   Transcript: ENSTRUT00000010151
Sequence length 2549
Comment pep:novel scaffold:FUGU4:scaffold_181:37993:69726:1 gene:ENSTRUG00000004257 transcript:ENSTRUT00000010151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANASSDLDNAEAQRQLNNNNRSIGSGFWETECTSSKLFECSRIKALADERDAVQKKTFT
KWVNSHLSRVSCRISDLYNDLRDGYMLTRLLEVLSGELLPRPTRGRMRIHCLENVDKALQ
FLKEQRVHLENVGSHDIVDGNHRLTLGLIWTIILRFQIQVIKIETEDNRETRSAKDALLL
WCQMKTAGYSEVNIQNFTTCWRDGLAFNALIHRHRPDLIEFHKLTRSNATHNLQLAFNVA
EQHLGLTKLLDPEDVNTENPDEKSIITYVVSYYHYFSKMKALIVEGKRVGKVLDSCIEAE
NIVNRYEALASDLLDWIEKTIAVISNQKFANSLTGVQQQLQAFTTYCTIEKPIKFQEKGN
LEVLLFTIQSKLRANNQKPYVPHDGKLISDINKAWERLEKAEHERGVSLRKELIRQEKLE
LLAQRFDHKTTMRQAWLNENQRLVSQDNFGYDLPAVEAAMKKHEAIEADIASYEERIGVV
VELSAEMESEGYYDIRRILARKENILGQWKLLKELVAGRRTRLEKNLALQKIFQDMVYMI
DWMEDTQVQLLSKDYGKHLLEVEDLLQKHSLQEADIAVQAERVESLNKAALKFTTIEGYQ
PCDPQVICNRVNHVSSCLEELKQLASKRCNDLEESRELWAFLQELEESEAWIREKSAILG
AQGFGKDLTSVLKLLQKHKTLAGELLAHRSLLQNTIKQGKQILSEKSLGTAGMQEHLMEL
KNQWKRLEDQAAQRLGHLQEALNFFQFSTEMNDLVAWLQDAYRLVSSEDFGHDEYSTQSL
LKKHRGVSEAIDKHRLHVVTLHKHMVALALHYRDQEEVQVRMVEVEQLYTEVVDVAVLRQ
QWLHDALAVYRMFSEVNACELWIDEKEQWLDKMEIPEKLDDVEVVAHRFESLDQEMNSLM
GRILDVNQIVQQLLDGGHPSSTEVRSCQDHLNSRWNSIVELVEQKKNQLNSMLRLQNYLL
ECVEIKSQIQDKRKAIDATQYMGSDLGGVMALQRRLSTMEGALSVLEPKLLHLQEEAENL
ATAHPSRAMEVLVPFDDLSVEWEELKHTLQGCEDSLMVASRLQSFIQDLDSFLTWLVQTQ
TVAASDQLPNDLEEAETLINKHAALKEEIGRYEEDYERLQSMNELLDSDEAPLPQAALQQ
WLQKLDVGWNKLLEMWESRREVLVQAHIFHLFLRDVKQAESLLNNQESALAHVELPTTVE
TVEASIKKHKDFTTTMELNLHRIKAVIEAGESLISQNNIYSERIRERIDTLAKRGNQNRE
LAQQWLEKLNIQWEVQRFLQNCHEIGDWVYEKMLMARDSSRDETQKLHKKWLKHQAFMAE
LAQNKEWLGKIEKEGQQLIQEKPELSPVVRKKLEEIRDCWQDLESTTQAKARQLFEANKA
DLVVQSYESLDQRLNQLEDQLSYVDQGQDLTGVNNQLKKLQTMENQMEAWYKEVGQLQVQ
VATIPQQTQVKETVTEHQSAVEARMVRLIEPLKERRRILLASKELHQVGRDLEDEILWIQ
ERLPMAMSQEHGATLQEVQQLMKKNQTLQRELQGHKSKLEDVLERAGIIASIRSPEADNI
GAGHDQVAQLWNLLWVETERRQLVLDAMYQAQQYFFDTAEVEAWLSEQELHMMNEEKGKD
EPSTLQLLKKHLVLEQTIEDYAETIGLLSQQCRQLLEMGHPDCELISKRQSQIDRLYVSL
KDLVEERKSRLEQQYWLYQLNREVDELEQWIAQKEVVASSPELGQDFEHVTVLQDKFTKF
ATETGSVGQERVTAVNQMVDELIDYGHSEAATIAEWKDGVNEAWADLLELMETRSQMLAA
SHQLHKFFSDCREVLTQIDDKHRRLPEVRAKQGNTANTSTLQRLLHGFEQDIQLLVTQVR
HLQESAAQLRTVYAGEKAEAIACCEHEVMQSWKELLTSCEECRVEITTETDKLKFFGMVR
DQIIWMDSIICQIGTGEKPRDVSSVEVLMNYHQSLKSEVEARSRSTLECIEMGKTLLAVR
NPAAEEIKEKLEKVVAKQHELSEKWDKHWEVLQQLLEVHQFAQEAVVAEAWLTAQEPLIK
SSQLGESVDEVEQLIRRHEAFRKAAATWEERFSSLRRLTTVEKLKAEQSKLPPTPMLGRK
VFLDPQDAIPSPATLPRLPISPVTRQTIYEQNDASSPPSPSPATPTPSPSSVARRLGSTV
ANYTPVMNGSSYRHTLEPRHAGVVGVAAGLGQPSPSSIASIATAAMLVSANQMRESANTT
KEQATNEQLIQARRDELPQEVWREHAERRERRTLERQTSSEQEGHGGLDVRRRERDRHRL
ERQESSEHDTGHSDRRSGGGERRSTMAEIVEQVQQTAKKNQKKQPGPGLKTTMNNLKARG
EVPRLPNGIPEKSSRPDRPRARDRPKPRRRPRPREAGDMTARRSRSAPAQSSPAVPQPPT
HTAHHEGFLFRKLDIESLKKSTNSRSWVNLYCVLNKGEIGFYKDAKNTSTPYNNEPLLNL
SHCHCDITNGYKKKKNVFTLKTKEGSEFLFHAKDEEDLKAWVNNITTSISEHEEIAKRDQ
PQPTTSSTDEGTRREGSKLDNRSEKGAER
Download sequence
Identical sequences H2SCG6
31033.ENSTRUP00000010095 ENSTRUP00000010095 ENSTRUP00000010095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]