SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010155 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010155
Domain Number 1 Region: 5-54,82-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-49
Family G proteins 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010155   Gene: ENSTRUG00000004283   Transcript: ENSTRUT00000010211
Sequence length 232
Comment pep:novel scaffold:FUGU4:scaffold_263:117393:119954:-1 gene:ENSTRUG00000004283 transcript:ENSTRUT00000010211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDVLTTLKLLIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTLAIDGNRAKLA
IWVRLKPFSRHFHMVATLRSCKLLRVFNNDTAGQERFRTLTPSYYRGAQGVILVYDVSRR
DTFVKLENWLNELETYTTRMDLVKMLVGNKIDKDDREVDRNEGLKFARKHSMLFIEASAK
TKDGVQCAFEELVEKILQTPGLWESDNTGQRLQLGEQQQGGGRACGGYCSIP
Download sequence
Identical sequences H2SCM5
31033.ENSTRUP00000010155 ENSTRUP00000010155 ENSTRUP00000010155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]