SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010535 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010535
Domain Number 1 Region: 107-194
Classification Level Classification E-value
Superfamily E set domains 0.00000308
Family Filamin repeat (rod domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010535   Gene: ENSTRUG00000004429   Transcript: ENSTRUT00000010593
Sequence length 566
Comment pep:novel scaffold:FUGU4:scaffold_167:468069:470836:-1 gene:ENSTRUG00000004429 transcript:ENSTRUT00000010593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTQLTNKSVLIFLIHPFVFACICLTQAVSLSQTQTQTQTQYHEPKDTMATVMVPKVYTYS
HNNHQNFCVYRPLSPKDALEEKLLLESISWPATPVWPEPLSLERTTDPAHSTFTILPRNG
GGQWQEGDRLEALIKLRDFRGLPKTSGGDVLLARMHDPVLSAGVAGQVVDHGDGSYSAFF
SLLWKGRAQVEVTLVHPSEAVTVLRRLTKEQPDRISFQSLFSSGGHSETTTCNVCLRPTQ
QPICNYVDPRTGEPWVCLKPKTLGCHTRINHSKGAFVQDLKPKEELLFQSGVNMKVSIPP
SGPDTITVLRRKKGAAEVKSGNLESPVGYYYQGVWRALDGTTIQQFHTSSAVCQCLKGKM
IHLYGDSTIRQWYEYLVATVPDLKDFNLHSRTQVGPFMALDYTNNIMVTYRCHGPPIRFV
DIPVSELRYIANELDGLVGGANTVVVIGIWSHFSTFPHQVYIRRLLSIRGAVERLLDRAP
DTLVVIRTANLKELTLYETLTNSDWYSMQRDKLLRAMFRGLNVRLVDAWEMGLAHELPHS
LHPQPAIIKNMTDVLLSYICTPSTKR
Download sequence
Identical sequences H2SDQ4
ENSTRUP00000010535 31033.ENSTRUP00000010535 ENSTRUP00000010535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]