SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010581 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010581
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-37
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010581   Gene: ENSTRUG00000004449   Transcript: ENSTRUT00000010639
Sequence length 316
Comment pep:novel scaffold:FUGU4:scaffold_84:32853:35051:-1 gene:ENSTRUG00000004449 transcript:ENSTRUT00000010639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLSSEELAAIEDEEVLNKMMDTAADFEDRRLIRAALRDLLKRKRDKREQERGSRQQDLKE
QVLSKGGGSTAARQQTATKSALTEVPLRVTKQVLVGKEHNGSKCLALKKKNSKVCFYESC
ITLLWPPTLKHLRLHNAIAGPHDLHLPAPASRGFITLNSLVLTFMFCRRSSSSVSVLHSQ
ASQSAASVQKSPPAAVPNAKNVKQMLLDWCRAKTEPYEGVNIQNFSSSWKDGIAFCALVH
RFFPDAFEYSTLNPSKPRDNFQLAFSTAERLAGCPPLLDPDDLVRMSEPDWKCVYTYIQE
FYRSLVEKGLVKTKKR
Download sequence
Identical sequences H2SDV0
31033.ENSTRUP00000010581 ENSTRUP00000010581 ENSTRUP00000010581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]