SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011154 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011154
Domain Number 1 Region: 953-1082,1114-1325
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-68
Family p120GAP domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 30-191
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-36
Family Calponin-homology domain, CH-domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 1532-1626
Classification Level Classification E-value
Superfamily RGC domain-like 6.93e-28
Family RGC domain 0.0000168
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000011154
Domain Number - Region: 698-817
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00023
Family Motor proteins 0.027
Further Details:      
 
Domain Number - Region: 670-700
Classification Level Classification E-value
Superfamily WW domain 0.000378
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011154   Gene: ENSTRUG00000004702   Transcript: ENSTRUT00000011214
Sequence length 1627
Comment pep:novel scaffold:FUGU4:scaffold_270:54060:67343:-1 gene:ENSTRUG00000004702 transcript:ENSTRUT00000011214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRRRKNGGNAAYIERLTAEQMDEQRVQNVAYQYLCRLEEAKRWIEACLGEELPAPTELE
EVLRNGVILAKLGHRFAPNAVGLKKIFDPEQQRYQAVGLHFRHTDNINQWRNALIAVGLP
AIFHPETTDIYDKKNMPRAIYCVHALSIYMYRQGLAPQIQDLYGKVNFTEEEINNMKLEL
DKYGIHLPAFNKIGGILAKELSVDEAAVHAAVIAINEAVDRGHLEITAASLRNPNALLSD
LQEAQMSVYQEMLRQAKAKKKQHAAIKLGAHEDKDIYEEFLTWREIQDTITLVNIRAAVE
QVDEALDSSNQPDLLTALQLSSLALRGLRRDNGPWYLDQLLADRQLKALEQGCVDPLEPA
ELQEGVTMANCTAERSRAMHTAMQNLNASLRLDDARRTVSCLMVAELQLPEVFPFAATLY
HDELKVLQRRAPQGEMQQEELFVAVEMLSEVALINQALEVGQLHQFGSLLTSPSAGLSDV
DPTLFHRYFKFLLDMKQQMAMICSPGIVQEGVDSVNNSVEDVKEELLAVAEINEAVDRGD
SRKLLASLLLPSCGIDEVSAANACRYLTLLTRYRQRKAQVSRDGAAELWLADIQEAVKEA
NQESQNTLKMCLAVAAVNQAVKENKVSQTLRVLTMPETQLQGIISACAADYQRELYSLIT
DRIHADNRSPWVRACLNDGSFYYFHLNKLEGCWEKPKGFVQNSMFLQQHQIQEVVSSVSG
LYSRRGLWRGSQALVVRLQALSRGFLLRQQLQARRRYLMVHTPAVILIQAHWRRVVQQRK
YRRRLQFLYMNWRAVVKIQSYVKMWLAMKNYRTRLNFFRENVGAVVKIQAFFRASKAREE
YRMLVHSGTPPLAVVRKFIHLLDLGDGDIREEAELLRLRKEVVQSIRFNRQLEEDLNLMD
LKIGLLVRNKATLQEVVTHCKKLTKKNKEQLSGMLDMERSKGLKALSKERRQRLEAYQHL
FYLLQTQPLYLAQLIFLMPQTRSTSFMEMLVFSLFNYGSDGRDAFLLLQLFTEALRYEIS
LKVEKPQDVITGNPTVIKMLVNFYRNAHGQNALRDSLGPALQDILMDKDLSIRTDPVDVY
KTWINLSETQTGCKSSLPYDVSPAEALTHPEVQRRVEVAVVNLRNLTDRVLKAITSNLSK
LPYGLRYTAKVLRDSLQLKFPGASEEELYKVVGNLVYYRYMNPAIVAPDGFDVVDRSASS
TLQPEQRFILGSISRMLQQAAANKHFHGDGPHIRALNQYISQTHSRFRKFLVCVCDVPEP
KDRFNVDEFSELLVVNKPVIYISVSELLNTHKLLLEHQEALCADPSDPLRLLLQDLGCVP
TLQELMGESSADPGSEVSLTLTNRFNIFDETDQVYTRGLLLSTKQLIIDVIRTQSGDSLS
DILRASVSHDEKVCHDWLMQRRAQREALTPEKIKRNPTLIANSSLSLEEKKRKILKSLCR
LEALGALKPPHSENQILHMIAKDICQRRLHRQCRGAELQKLGQTLCSLEAKTCFHSEQVD
YYSDYITSCLDNLTAKRKAAEGKGRKKLCVVSYSAVQLHEKGVLLEIQDLPNTQFKNVIF
DIIPGSETGSFVVKARFLGVEMEQFPLKYQDLLHLQYEGVAVMKMFDKAKVNVNLLIFLL
NKKLLKK
Download sequence
Identical sequences H2SFH3
ENSTRUP00000011154 31033.ENSTRUP00000011154 ENSTRUP00000011154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]