SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011270 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011270
Domain Number 1 Region: 26-258
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-88
Family Calponin-homology domain, CH-domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 276-398
Classification Level Classification E-value
Superfamily Spectrin repeat 9.59e-35
Family Spectrin repeat 0.000000451
Further Details:      
 
Domain Number 3 Region: 512-633
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-27
Family Spectrin repeat 0.00000273
Further Details:      
 
Domain Number 4 Region: 399-507
Classification Level Classification E-value
Superfamily Spectrin repeat 9.42e-25
Family Spectrin repeat 0.00000273
Further Details:      
 
Domain Number 5 Region: 637-748
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-20
Family Spectrin repeat 0.00000184
Further Details:      
 
Domain Number 6 Region: 741-890
Classification Level Classification E-value
Superfamily EF-hand 5.53e-20
Family EF-hand modules in multidomain proteins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011270   Gene: ENSTRUG00000004737   Transcript: ENSTRUT00000011330
Sequence length 896
Comment pep:novel scaffold:FUGU4:scaffold_121:140955:152004:1 gene:ENSTRUG00000004737 transcript:ENSTRUT00000011330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMMMMMENTVHYDNGYEDEYMLQEEEWDRDMLLDPAWEQQQRKTFTAWCNSHLRKAGTQ
IENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALEFISSKGVKLVSIG
AEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHV
SWKDGLAFCALIHRHRPDLLDYSKLNKDDPLGNLNLAFDIAEKHLDIPKMLDAEDIINTP
KPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLGVNQENEKMMEEYERLASELLEWIR
RTTPWLENRTPEKTMAEMQRKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRISNRP
AFMPSEGKMVSDIASAWQGLEQAEKGYEEWLLTEIRRLERLDHLAEKFHQKATNHENWAS
GKEVFLTQKDYETATLTEIRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVAA
VNQRCQSICDLWDKLGTLTQKRREALERTEKLLETIDQLFLEFAKRSAPFNNWMEGAMED
LQDMFIVHTVEEVQSLIAAHEQFKATLPEADSERQAILGIHNEVLKISQSYGIKAKIVNP
YSIITIEELLNKWEKVKKLVPQRDGALQEEMARQHAHERLRRQFAAQANLIGPWIQTRME
EIGRCSFEIGGTLEDQMTQLKQFEHVIVAYKLNIDKLEGDHQLIQESLVFDNKHTNYTME
HIRVGWELLLTTIARTINEIETQILTRDAKGISQQQMNEFRSSFNHFDRKKTGAMDTDDF
RACLISMGYDLGEVEFARIMMLVDPNATGIVSFQSFIDFMTRETADTDTAEQVVASFRIL
AADKPYILVEELRRELPPEQAEYCILRMPAYSGPGTPPGALDYTAFSTALYGESDL
Download sequence
Identical sequences H2SFT9
ENSTRUP00000011270 31033.ENSTRUP00000011270 ENSTRUP00000011270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]