SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011348 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011348
Domain Number 1 Region: 408-804
Classification Level Classification E-value
Superfamily RNI-like 1.96e-75
Family 28-residue LRR 0.00000822
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000011348
Domain Number - Region: 6-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000219
Family G proteins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011348   Gene: ENSTRUG00000004765   Transcript: ENSTRUT00000011408
Sequence length 818
Comment pep:novel scaffold:FUGU4:scaffold_2771:552:7021:1 gene:ENSTRUG00000004765 transcript:ENSTRUT00000011408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVVLTNGVAGVGKTFSVQKFTLDWAEGLENQDISLLVLLSFRELNLIKDEQHSLLSLLHV
FHPTLQKIRAEDLAACKLLLIFDGLDESRLSLDFNKEQVISDVTQVSSASVLLVNLIQGN
LLPSALIWITSRPAAANQIPPSYVDRITEIRGFTDTQKEEYFRRRFRDEDLSKRIISHIK
ASRSLHIMCLIPVFCWITATVLEHMLTTEQRGELPKTLTDLYSHFLLVQTKRKKQKYGGH
KGPEELTESDKEVLLKLGRLAFEHLENGNILFYQNDLEQCGLDVSEVSVYSGVCTEIFRR
ETVIFQKSVYCFVHLSIQEFLAAVYVFHCYTSKNTAVIHSFVKVMMKSLESPNGHLDLFV
RFLHGLSLESNQRILGGLLNQTDNNPETIQKVINNLKEMSSEQISPDRSINIFHCLMEMK
DHSVHQEIQEFLKSEKNSEQELSEIQCSALAYLLQMSEEVLDELNLKEYNTSEEGRRRLI
PAVRNCRSMFYINKSIRNLTKDSALRVRTFQFLTSCMKFLDLLKNIQIIFDLFGVKYIYW
FTNINKIILKLSYNQLQDSGVKLLCSGLENPNCKLETLGLSSCSLSEISCGSLASALKSN
TSHLRELNLSQNRLQDSGVKLLCSGLESPNCKLETLRLWGCSLTEISCGSLASALKSNLS
HLRLLDLSYNQLQDSGVKLLCSGLERPNCKLETLRLSSCSLSEISCGSLASALKSNLSHL
TELDLNENQLQDSGVKLLCSGLESPNCKLETLRLWSCSLSEISCGSLASALKSNPSHLRE
LDLNENQIQDSGVKLLSDLVKIQQFCSPKLRSIEVTSF
Download sequence
Identical sequences H2SG17
31033.ENSTRUP00000011348 ENSTRUP00000011348 ENSTRUP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]