SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011569 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011569
Domain Number 1 Region: 50-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.66e-28
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 228-301
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.31e-25
Family GAS2 domain 0.0000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011569   Gene: ENSTRUG00000004843   Transcript: ENSTRUT00000011629
Sequence length 334
Comment pep:novel scaffold:FUGU4:scaffold_657:40907:44450:-1 gene:ENSTRUG00000004843 transcript:ENSTRUT00000011629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSSCTLQVCFGEKFKAPLLRPRCPRSPLAQRHGPGLADVFQYDQWLAVRHEATLVPMQE
DLAIWLSGMLGEEVRAEFFMEELDNGVKLCKLVGVLQTKVAQSCPVSQAGQLFPVRKVTC
KRDASPGSFFARDNTANFLSWCRHIGVEETYLFESEGLVLHKEPRQVCLCLLELGRIVSR
YGVEPPVLVKLEKEIELEESRMLTEEPPPVVKTFSVCCQHGGLYPSGDQDVDEPPCNCSN
KVSIEYLSEGRYRLGDKTLFIRMLHGKHVMVRVGGGWDTLRGFLLKYDPLRVLQFTTLEQ
KILAFQKGPPCVGGHHGNAAPPPPPDMDPLSAVN
Download sequence
Identical sequences H2SGN7
ENSTRUP00000011569 ENSTRUP00000011569 31033.ENSTRUP00000011569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]