SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011852 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011852
Domain Number 1 Region: 14-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.82e-50
Family G proteins 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011852   Gene: ENSTRUG00000004955   Transcript: ENSTRUT00000011912
Sequence length 175
Comment pep:novel scaffold:FUGU4:scaffold_328:66728:68274:-1 gene:ENSTRUG00000004955 transcript:ENSTRUT00000011912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQMPSEKTSPQTGPQRVFKVVFLGNSGVGKTSFIHRSCTGELRRKLSATVGIDFQMKTLT
VGSATVTLQLWDTAGQERFCSITEQYYRKADGILAMYDLTQSASFAAVRGWMHSVKEKAC
DGAVLVLLANKLDRADRRQVAASEGQGLAKQHQALFYECSARNGCNIEEVMTELA
Download sequence
Identical sequences H2SHH0
ENSTRUP00000011852 ENSTRUP00000011852 31033.ENSTRUP00000011852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]