SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011984 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011984
Domain Number 1 Region: 3-327,445-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.86e-49
Family FAD-linked reductases, N-terminal domain 0.00076
Further Details:      
 
Domain Number 2 Region: 312-423
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.46e-24
Family L-aminoacid/polyamine oxidase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011984   Gene: ENSTRUG00000005004   Transcript: ENSTRUT00000012044
Sequence length 479
Comment pep:novel scaffold:FUGU4:scaffold_148:227846:232401:-1 gene:ENSTRUG00000005004 transcript:ENSTRUT00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMKTVAVLGGGIAGLAASYYLCRSPQVTKVILLESSSRVGGWLSSTRRPDGAVFEHGPRG
IRPAGAVGRNTLNMVDDLGLQDEIVPVSYSHVASKNRYLYVNKELHKMPSGIRGLLQTVP
PFSRPLLFNLVKEILVKKGQEDDETIHSFFCRRLGKEFADIAVDSLCRGVFAGDCRKLSV
RSCFPLLYNAEQRRGSVLLGMMLGSGPSPVVPPGPLALRSVKESWAQWSLRRGVESLPES
IAELLQRSGKVELHTDAPVKEIHPSASDWKIRLEDGLISADHIISALPAKALSSVLPSSC
LPLTQRLMEIETVTVAVVNLEYEGSVLPVEGFGHLLPSSEDQAVLGVVYDSVAFPQHNRP
TGETTRLTVMMGGAWFHRAGGSLGAVTQGDLLSRATEAVRDHLDVTAAPIWSHVEIQKDC
IPQYYEGHAQRVESMRNFIKKENLPLSLIGSSYDGVSVNDVIFSGRTAAEELLGAQFNG
Download sequence
Identical sequences H2SHV2
ENSTRUP00000011984 ENSTRUP00000011984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]