SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012214 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012214
Domain Number 1 Region: 185-380
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-47
Family DBL homology domain (DH-domain) 0.000000146
Further Details:      
 
Domain Number 2 Region: 373-496
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-28
Family Pleckstrin-homology domain (PH domain) 0.0000221
Further Details:      
 
Domain Number 3 Region: 117-182
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-25
Family SH3-domain 0.0000536
Further Details:      
 
Domain Number 4 Region: 5-65
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000964
Family Calponin-homology domain, CH-domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012214   Gene: ENSTRUG00000005093   Transcript: ENSTRUT00000012274
Sequence length 761
Comment pep:novel scaffold:FUGU4:scaffold_132:160698:174458:-1 gene:ENSTRUG00000005093 transcript:ENSTRUT00000012274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCQYCQEPRTESDCISNIREFLRGCSSLKVEGFEPDWLYTGENFGKVLTTLLAVNFATQG
KTFARFGMSVQLGSGSVLSFCLLKSAASHSLSTIKSKSSLRRQSKSVEMAENGGGGQLTV
KARFNFKQNNEDELSFSKGDVIVVTRQEDGGWWEGTLNGKTGWFPSNYVREIKPCEKPVS
PKGTQLTKNYYSVVVQDILEHEREFVKELQTVLSCYLRPLQASDKLSASDCLMLCGNLEE
ILTFQQGLCVALEECTKALEGQQRVAGCYLNLMSQVKTLYLAYCSSHPSAVSILTDHSEE
LDKFMESQGASAPGILTLTTSLSKPFMRLDKYPTLLQELERHVEEAHPDYSDILKATAAF
KSLVTQCQDLRKRKNLELQILSEPVRAWEGDAIKSLGNMVYMSQVHIKNGSTEEKEERYL
MLFPNLLVMISASPRMSGFIYQGRFPLTGAAVTRHAEDADSGLYAFDIAGSMIDRITVYC
SSAQELQEWLDNLQPFTKGGSPAGTIAKVIPQTQYKLKTAANIPTQSVEGKPLSMVGAPT
HLSHLGSFSALSRGPLEPPKISKPWSLSCLRPAPPLKPSAALGYKEDSSKSPRPMKKFLP
GNRKKERKHSDDEVQIRKSTVALEEDAQILRVIEAYCTGASLHQNTTGVFGSSGLIRQSL
SRLPVNLCAAVRKECVPQVLLPEEEKIIVEEMKSNGQTVIEEKSLIDVVYALKDEVLELK
KENKWMRQFLEDEQKSRKELERVIRKISKQKNDCTWDDGGH
Download sequence
Identical sequences H2SII2
ENSTRUP00000012214 31033.ENSTRUP00000012214 ENSTRUP00000012214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]