SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012230 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012230
Domain Number 1 Region: 629-773
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.54e-49
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 457-577
Classification Level Classification E-value
Superfamily E set domains 1.34e-36
Family SVA-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000012230
Domain Number - Region: 134-192
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0247
Family Invasin/intimin cell-adhesion fragments 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012230   Gene: ENSTRUG00000005099   Transcript: ENSTRUT00000012290
Sequence length 773
Comment pep:novel scaffold:FUGU4:scaffold_300:18254:24055:-1 gene:ENSTRUG00000005099 transcript:ENSTRUT00000012290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPKFKVSLQAPNEVSVGKEELEMDVCAKYTYGQPVPGMVNIEICRRPSSYLTDQIPGLC
FKEAKQTDKTGCAKFNPKMSVFTKIEATAFHPSLHITASVEEEGTGTSLPAEKVVELSYI
IGKLIFVETPKIYNEESTLEGKIKAVHHNDTPVPNMEIQLLNAIGWQDWVLLNLTTDAEG
IATFSLNTTLFNGEDIRLKASAVRQDRNFLEPFFDSAHHTVSVFQPPLPFSKSVSSLVMN
KKEEALSCDGEETISIRYNFVGETAGNVDVIYLIMSRGMIITQGFKMVEILKDPGMTEGS
ISFSVKMSPELSPALQVMAYVILPSENVIAHKADFTVTKCFLNKVSVEFSPTSAVPGEEV
KMKVKALPNSLCGVSAIDQSVLILEPGETMTADMVNARTKFNQDIFVKVLGEAQSDHSRD
SAQTDLPLTVPDTITTWKTEAFCLSPQGFGLAPQNEITVFQPFFLELSLPYSIIRGEQFE
LKATVFNYQSTCMMVSVKATPSDEYTLTPLSGNEYTSCLCGSERKTLSWTMVPSVLGVVN
VTVSAEAIASHASCDNEIVSVPERGRIDTVTRSLIVKAEGTEMKKINNWLLCPNDEVLKE
EVKLELPDNAIDGSARALVSVLGDIMGRALQNLDGLLKMPYGCGEQNMALLAPNIYILQY
LRSTEQLTDDILKKAFHFLTSGYQRQLNYKHWDGSYSAFGIGDGNTWLTAFVVRSFEKAK
AFIYIDPTKMDESKNWLLGRQKEDGCFAQSGKLFNNRMKGGVSDEVTLSAYIT
Download sequence
Identical sequences H2SIJ8
ENSTRUP00000012230 31033.ENSTRUP00000012230 ENSTRUP00000012230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]