SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012578 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012578
Domain Number 1 Region: 971-1098,1130-1335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-78
Family p120GAP domain-like 0.00046
Further Details:      
 
Domain Number 2 Region: 36-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-37
Family Calponin-homology domain, CH-domain 0.000023
Further Details:      
 
Domain Number 3 Region: 1568-1665
Classification Level Classification E-value
Superfamily RGC domain-like 6.41e-34
Family RGC domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 714-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000726
Family Motor proteins 0.034
Further Details:      
 
Domain Number 5 Region: 687-719
Classification Level Classification E-value
Superfamily WW domain 0.00000513
Family WW domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012578   Gene: ENSTRUG00000005240   Transcript: ENSTRUT00000012639
Sequence length 1665
Comment pep:novel scaffold:FUGU4:scaffold_4:638753:659929:-1 gene:ENSTRUG00000005240 transcript:ENSTRUT00000012639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISRTDELTSRGNDKPRYGTIQDDERLSAEEMDERRRQNIAYEYLCHLEEAKQWMEACLEE
ELPPTTELEEGLRNGVYLGKLATFFAPKMVSEKRIYDRDQSRYKSSGLHFRHTDNTVQWL
RAMESVGLPKIFYPETTDVYDRKNMPKVVYCIHALSLYLYKLGVAPQIQDLLGKVAFTEE
EISNMRSELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRGQAPATMAAL
NNPNAMLKNAKEALAEDYQNTLSQAKTRKLNQSSSNQRRSSETEERDVYEELLTQQEIQG
CLDLINSKAAVQQVNRAVSAQDQPALLAALRLEALALLGVLDPNCHWYMEHFTTYCQHKL
KDGGRAMLVDKEEIQRVVSSCNDFAEAERRKLEAVASINKAIRLGNAAETVEELMNPEAQ
LSIVYQTAANLYQNELFSLQLQGGQAGLSHEELSVAVEMLSAVAVLNEVLDTKDPQAVIE
QLADSPLGFTNMDQDNLNRYADTLIQQRGETLAKGQEFLTWNDVQKCIDTVNVQVHEEHE
RIIAIAEINEALNSADPQQTLAALLLPTAKLMAVNPGTAKHYHDVLQYTKRLLCQSSGDE
SAVLWLDQIQEAIHTANQDEEKALAFAGAIADINRKVAKGNSKNTLQALQLPSAGLRAVH
PDCADTYQTKLAESQANDANKGSSDSVWVKHCFSDRYLYYYNLETGQGTWEEPEGFHHRG
DHLCKEEIQNVVSSVTAEYNREQLWLANESLVTQLQARIKGFLVRKRHKQRMEYLQQQEP
HVIKLQACWKGCKQRKLYKKRMNLLEKNVASVVKIQSMVKMWKAKREYNKRLQFFKDHEK
DIVKIQAFLKANKARDDYRTLTMAKDPPLSVVRKFVHLLEQSALDLQEEQDFTRLREEVV
TNIRSNQQMEKDLNMMDIKIGLLVKNRITLQDVVSHNKKMNTKKMKSEMDLTTGDKLGIK
GLSKGKRRKLEAYQHLFYLLQTNPSYLAKLIFQMPQNKSTKFMDTVIFTLYNYASNQREE
YLLLKLFKTALEEEINSKVDQIQDIVTGNPTVIKMVVSFNRGARGQNTLRQLLAPVVKDI
IEDKNLNINTNPVDIYKAWVNQVESATGEASKLPYEVTPEQAMSHAEVRSRLEASSLALR
TATDKVLNSIVSSLDNIPYGMRYIAKVLKNSLHEKFPDASEDELMKIVGNLLYYRYMNPA
IVAPDGFDIIEMSAGGQLALDQRRNLGSVAKMLQHAAANKLFEGENAHMTPMNIYISQTY
EKFRVFFQSACDVPELEEKFNIDEYSDMVTLSKPVIYISIEEIINTHSLLLEHLDAISPD
SNDLLHELLQDLGDVPDREALLGEGAVDPSDPNRENTLSHLAKTEVSLTLTSKFELLEGD
DKDFKTLMTKTKKLIVDVIRIQVGENLPEILETPSTAPQELEHKKIVERRAVQDAQTPEG
LKSSAAVLEDSQLPLEQKKRKILRNLRNLEQAGLCTDANKYQDIINEISKDIRYQRRYRQ
RRKAELVKLQQTLTALNSKTAFYQDQMNYYDTYIKTCLDNLNRKNSRRSIKLDNKGEEKG
SKKWKPQSLKYTAARLHEKGVVLEIEGLQTNQFKNVMFDISPTEEVGDFEVKAKFMGVEM
EKVQLHFQDLLQLQYEGVAVMKMFDKAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences H2SJJ5
ENSTRUP00000012578 ENSTRUP00000012578 31033.ENSTRUP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]