SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012594 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012594
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.58e-48
Family Calponin-homology domain, CH-domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 185-244
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.88e-19
Family EB1 dimerisation domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012594   Gene: ENSTRUG00000005250   Transcript: ENSTRUT00000012655
Sequence length 261
Comment pep:novel scaffold:FUGU4:scaffold_247:232914:234477:1 gene:ENSTRUG00000005250 transcript:ENSTRUT00000012655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVFSTSMTIENLSRHDMLAWVNDSLQLTYTKIEQMCSGTAYCQFMDMLFPGCIMMKK
VKFNAKLEHEYIHNFKVLQSSFKKMDVDKIVPVERLVKGKFQDNFEFLQWFKKFFSANYD
GKDYDPVLTRQGPETTLPPSHPGSLRSSPSPTAVKPVPTPPRQNSAAAPRRTTSVTRNGV
DAEVLVLSQQLSELKLSVEGLKKERDFYFRKLRDIEVICQEHENDHPGISRIMDVLYATE
EGFIPPDEGGEDGEQGDHGEF
Download sequence
Identical sequences H2SJL1
XP_003971974.1.43653 XP_011610603.1.43653 ENSTRUP00000012594 31033.ENSTRUP00000012594 ENSTRUP00000012594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]