SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012966 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012966
Domain Number 1 Region: 1137-1419
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.98e-41
Family C5 cytosine-specific DNA methylase, DCM 0.0063
Further Details:      
 
Domain Number 2 Region: 20-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-28
Family Calponin-homology domain, CH-domain 0.000088
Further Details:      
 
Domain Number 3 Region: 813-942
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.55e-27
Family PWWP domain 0.0000484
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000012966
Domain Number - Region: 1038-1108
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000475
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012966   Gene: ENSTRUG00000005403   Transcript: ENSTRUT00000013027
Sequence length 1420
Comment pep:novel scaffold:FUGU4:scaffold_226:285411:292891:1 gene:ENSTRUG00000005403 transcript:ENSTRUT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTPVETPQFIKKKSKGLHLVNWVNNLLKTDFKDVQQFGSGACHCQIMDWVIPGSVDMS
KVKFDAQCKDDYRHNFSLLCDAFRNNSITRTVPVENLIIGDFQSNLDLLRWLKSFYTTNV
RDEEYDPVKARHNLDISPALQQCDKAPTGLFCFLPLGTRKLKQATIRNGSFPYREKWKDM
FEWADRSALGDKYTYCCICHSNLSTLSKGIVDLRRHMMTNKHKTRSLNPRNQAPGSPPCS
DVAIWFIGEYCERATAPGAEVSAHLARSKLGSRYPRDIESACQRGPYCVYIYAGVTLKSS
REGGTIAVVLVGFFDVGANRHCVRFLDAFQSEGKEGNEMAAAVVKTLRGFKLPKENLVAV
YSEGNAESSEQIFLNLRELNPNVVAFGGLYTVADAACRAGLKELSKQVQELVADIYAYFS
SCPTKNINLEALFGSDFSTDSQTFLLNTSCLKCCSVVSKILEMWSELLLYFTSCNKSNEK
AKLICFQLQDCKVRATFMFLEQALKPLHRFQRCLQTQEEAAGARLQLMAEGASNLLCTYA
SLFLHPEAAGHFLKEPDAQNLENEKYHLSSLDLSVGDKAVEKYLKESVSKDAKLLLTQEA
LSFYIAVTRCITEKLPLGEGVLKSIAQLLSPHRWLKVAGKAVGELGTQLGICSSAEDATQ
LTDEFLQHRLLERGKEKRWASLLEDNEPNSLFRKLLLTLLAFPCPPLEPKAVFTKALEND
ADAEGDASRGSECDLVLSVSNTRPSTVKSCEVRLSSVERGKLFSTNRPTQKSLAETRGSK
RRGHKILTPLLHCQAEESSPTSKGTPKTHQRPSYQDGRGFLTGELVWGKLEGFSWWPGMV
MPWKSKPLPLGMRRVEWFGDGKFSEILTEDLLSFGTFGKCFCKNSFSSLPTYKEAIYQII
ELAAERCSKSFSAAGRDREKELKLMLDWASEGFLPMGPEGFAPAGNIAAAHQSSDSGLSD
YQPPVKRKLLLKNKSRTSGTTYSRELIVENINETGKTIEDFCLSCGSSETPVRHPLFEGG
LCVKCKENFSETLYRYDEDGYQSYCTVCCGGTEVILCENVSCCRCFCKDCLDMLVRPGTF
DKVKDIDPWKCYMCDPSQCDGNLKLRPDWRAKVQDFFANNTGMEFEPHRVYPSIPSDQRR
PIRVLSLFDGIATGYLVLKNLGFKIERYIASEICEDSIAVGMVKHEGKIEYVNDVRTITK
KHLAEWGPFDLLIGGSPCNDLSMVNPLRKGLFEGTGRLFFEFYRILTMLKPKEGDNRPFF
WLFENVVFMSANDKSDISRFLECNPVLIDAVKVSPAHRARYFWGNIPGMNRPLATAVEKK
VLLQDCLESGRTAKFDKVRTITTKSNSIRQGKTGPLPVNMNGKDDYLWCTELEQIFGFPK
HYTDVNNMGRTQRQKALGRSWSVPVIRHLFAPLKDYYECE
Download sequence
Identical sequences H2SKN2
31033.ENSTRUP00000012966 ENSTRUP00000012966 ENSTRUP00000012966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]