SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012978 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012978
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-47
Family G proteins 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012978   Gene: ENSTRUG00000005407   Transcript: ENSTRUT00000013039
Sequence length 205
Comment pep:known scaffold:FUGU4:scaffold_233:224987:228958:-1 gene:ENSTRUG00000005407 transcript:ENSTRUT00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIRVDAKVVMLGKESVGKTSLVERYVHHRFLVGPYQNTIGAAFVAKPIQLGEKVVTLG
IWDTAGSERYEAMSRIYYRGARAAIVCYDLTDSSSFQRARFWVKELQNCEEQCKIYLCGT
KNDLITADRSLRQIDYHDAQDFAEEIGAQYFETSSKTGNNVDELFHKVAEDYNNAAFQFM
SVNTEESGVDLGQKKDSYFYSCCHN
Download sequence
Identical sequences H2SKP4
31033.ENSTRUP00000012978 ENSTRUP00000012978 ENSTRUP00000012978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]