SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Takifugu rubripes 69_4 > ENSTRUP00000013025

Domain assignment for ENSTRUP00000013025 from Takifugu rubripes 69_4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSTRUP00000013025
Domain Number 1	Region: 22-208
Classification Level	Classification	E-value
Superfamily	L domain-like	5.39e-33
Family	Ngr ectodomain-like	0.007
Further Details:

Domain Number 2	Region: 224-299
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000000113
Family	I set domains	0.061
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSTRUP00000013025 Gene: ENSTRUG00000005427 Transcript: ENSTRUT00000013086
Sequence length	299
Comment	pep:novel scaffold:FUGU4:scaffold_266:104035:107040:1 gene:ENSTRUG00000005427 transcript:ENSTRUT00000013086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	ACPISCSCTYDGTGLSELSRLVQCSDSKMSSVPINVPSDTVRLRLEKTQISRVPRAAFYN LSELRFLWLTYNSITTVHPSSFVNLKALRELRLDGNFLASFPWEGLRDMPRLQTLGLHNN RLSSLPAHASVFLPNITYLDLSSNRLTTLPLEMLDLWFPLLDKGQAQRRILGLQDNPWIC DCQISMLMSLSMSLGSPVVLMDQLLICSRAVGQSTILLTPVQFSHCMRPSIQPAATRVIS PLGSNVILRCDATGYPTPALAWIKTSAYTVMQDSPRVGVRWSIIILNGLSYEDAGEYRC
Download sequence
Identical sequences	H2SKU1 ENSTRUP00000013025 31033.ENSTRUP00000013025 ENSTRUP00000013025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]