SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013071 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013071
Domain Number 1 Region: 385-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-34
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 87-246,382-465
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000259
Family FAD/NAD-linked reductases, N-terminal and central domains 0.053
Further Details:      
 
Domain Number 3 Region: 729-758
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000404
Family LIM domain 0.011
Further Details:      
 
Domain Number 4 Region: 697-728
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000124
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013071   Gene: ENSTRUG00000005444   Transcript: ENSTRUT00000013132
Sequence length 1120
Comment pep:novel scaffold:FUGU4:scaffold_199:96620:106202:-1 gene:ENSTRUG00000005444 transcript:ENSTRUT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMANQDPVNPAHTLFDLFVQAQRCVDVKQHFAELCRQLTLNPKDFRNFYSKLKERLNYWK
AKSLWTKLDKRASHSEYQQRKACIKNKCLVLGAGPCGLRTAIELSFLGAQVVVVEKRESF
SRNNVLHLWPFSISDLRGLGAKTFHGKFCTGSLDHISIRQLQLILLKVALLLGVEVHTGV
EFLGLNEPSGENGTGWMAKLKPETHPAATFQFDVLVSAGGGRFVPDGFKHKELRGKLAIG
ITANFINRKTAAEAQVPEISGVARIYNQKFFQQLLSETGIDLENIVYYKDDTHYFVMTAK
KKSLLEKGVIKEDHSDAEQLLAPSNVDYKALHLYAHDAAQFSTGGNLPHLQFAQNHLGQP
DVAMFDFTCMYRAENASLIRERRGKKLLTALVGDCLVEPFWPLGTGIARGFLASFDTAWM
VRSWGLGVPHLKVLAERESIYQILSQTTPENTSKNYGSYTINPRTRYVTVNLSSIHTNQV
RTLYFEFSLNVKPLKCGSSLLASSDSASGIKELLAWCQKNTAGYNKVNVNDFSQSWRSGL
ALCALVHRFRPHLIDMSSLDESNAVYNNQTAFSILEKELGIPPVMSARDMASNSQIDNLS
MVFYLTQIQEAFNVSAKAKASASKPLTLSQTQSALFFLTKLKHNSLQRRKEKFASEKQAR
EKRMGDDDTTSKPLPSPELPPVPAAASEPAPQPEVLMANSEECYFCGQRVYVLERISAEG
RFFHRSCFTCHQCGATLRLGGYTFDPTTGRFYCELHSEELELADGAEPSSENLLVTESLN
SLNGPSARAETHAGDPQSSNTPTNPPKSDDKEPEEPPANDPCPVPKPRQSWQTTPSPKPS
TPTAKPRTVLLFSPSTPDKQPPAEGSRADPDYRPKQSLRKLQLTNEEKTQLVNLHSLSAD
SDSETPDPPARVGKWDVLALLEVVWIDQNPSEEGVDGDDDDDDDETFEDDIDLLNEKFQK
VPSNPAEAEKLELMKMRTLERRAKTNELQRLRKAQSIQRRLEEIEVDFKDLEEKGVVLER
TLRASSGSPEMIEHWIELVLKKNSLVSEESDLMVASRQLELEDKQSAMELELRKFMEISE
KTPEQCAEEEQILQRLIEVVDMRHSLVLFLEEKRLKEISE
Download sequence
Identical sequences H2SKY7
ENSTRUP00000013071 31033.ENSTRUP00000013071 ENSTRUP00000013071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]