SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013131 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013131
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.22e-84
Family Calponin-homology domain, CH-domain 0.00000132
Further Details:      
 
Domain Number 2 Region: 2191-2385
Classification Level Classification E-value
Superfamily Plakin repeat 2.29e-40
Family Plakin repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1448-1665
Classification Level Classification E-value
Superfamily Plakin repeat 1.96e-37
Family Plakin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 1672-1839
Classification Level Classification E-value
Superfamily Plakin repeat 4.32e-35
Family Plakin repeat 0.00078
Further Details:      
 
Domain Number 5 Region: 5924-6082
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-30
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 5702-5864
Classification Level Classification E-value
Superfamily Spectrin repeat 5.3e-25
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 6161-6305
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-23
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 8 Region: 5160-5309
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-23
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 6379-6525
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 2471-2583
Classification Level Classification E-value
Superfamily Plakin repeat 1.15e-21
Family Plakin repeat 0.0016
Further Details:      
 
Domain Number 11 Region: 5496-5644
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 6876-6958
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.37e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 13 Region: 5378-5536
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 4272-4398
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-20
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 15 Region: 5050-5172
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-19
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 16 Region: 4609-4767
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 17 Region: 6520-6636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-18
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 18 Region: 1151-1283,1310-1336
Classification Level Classification E-value
Superfamily Spectrin repeat 1.86e-18
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 19 Region: 6585-6767
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-18
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 20 Region: 237-354
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-18
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 21 Region: 6308-6411
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 22 Region: 4516-4658
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-16
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 23 Region: 6091-6197
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 24 Region: 616-718
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000132
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 25 Region: 6787-6867
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000081
Family Polcalcin 0.072
Further Details:      
 
Domain Number 26 Region: 4027-4148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000823
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 27 Region: 3717-3829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000183
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 28 Region: 4825-4990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000985
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 29 Region: 4405-4540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 3840-3959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000072
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 31 Region: 3598-3703
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000979
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 32 Region: 4181-4290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000113
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 33 Region: 525-615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000628
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 34 Region: 2137-2214
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000114
Family Plakin repeat 0.0059
Further Details:      
 
Domain Number 35 Region: 690-800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 36 Region: 3378-3479
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000127
Family Spectrin repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000013131
Domain Number - Region: 1057-1155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00331
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number - Region: 1359-1467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 953-1087
Classification Level Classification E-value
Superfamily Spectrin repeat 0.023
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013131   Gene: ENSTRUG00000005469   Transcript: ENSTRUT00000013192
Sequence length 7148
Comment pep:novel scaffold:FUGU4:scaffold_240:266308:355543:-1 gene:ENSTRUG00000005469 transcript:ENSTRUT00000013192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVLSGVTLPREKGRMR
FHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVSGESS
DLSAKEKLLIWSQQATEGYPGLRCANFTSCWSDGRMFNALLHRYRPDLIDMEIVSQQSNQ
ENLEQAFEIAESLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEGGEGILVNEV
DKRWSEYQSRFSSLVQWSHQHTANMANKNFPQNPAELKALYNEYVHLKETEIPIKEVEKA
QIEHLYKLLEMWIEFGRIKLPQGFHPNDLEEEWGKLILEMLEREKALRPAVERLELLLQR
ANKIQNMALECEEKLTLAKNTLQADMSRIENGESVQCERELACYLQDCEALNQHLNQELK
VLRDEKYYQVDQLAFRVSCLQEELVSFRLQCSSIYRKGHFSQSLSSTGAEHTSQRAIDGG
LTLGQTLIGTMGAVGAALLRRPMARSQLVAMSSSEDEGSLRFIYELLGWVEETQELLEQA
EWGADLPTVENNLQEHNNIHTAVKELMSSVQEARTYEAKVSPNYKISYSDTLAKLEHQYC
KLLEHSSWRLQSLESLHGFVARCTEELIWLNEREEEEISFDWSDNNPNLSAKRELYSEMK
LELDAKQEAMQSLQETAHHLCQENHPAKQTVEAYSAALQTQWQWVNQLCLCVEEHMKDNS
AYFQYTSDARECESYLRQLQDTIKRQYTCDKNSRLSKLEDLLQDSMEEKEQLIEYRSTVA
SLVGRAKTVVQLRPRGAENILGSTTLIKAICDYRQIEITINRGEECVLQDNSQRTKWKVI
STTGNEAMVPSVCFTVPPPNLEAISAANRVEQLYQKVMSLWHQQHVNMKSVVSWHYLLKD
IRNISGWNVDTVRCQSPAERQEVLTHLESHLADFLADSKESTLFTPGDRRQLEEDAEQAQ
QHCQKLVVNMETVEKDESVSRAYLSELQNITLHLKEAEQRLMTAIETPGRPSADGADVTL
QIEAQKKLQSELGSLCATLGDLSGRCISFFEEKPTSSSIPALRSELNYTMEKTDQLHNLS
SVYLEKLKTIDILLHGLNEAESQVRKNESRLSEEDIVPADITAIKSLRDQLGKWQAELAE
HEDIFHTLQSRVDRAKEVGSQLNRLHPDRSPELERYQERASQIAERWNGIKRQMETRRTD
LEALGAALKHYRDGHSDLINWIEDTTQRQENTPPGQTDSRGLSEQLAQQTALVAEIEQNQ
IKLNECQTHSKQYCTLVKDYELQLMTYRAFVESTHKSSVKRRRMHSSSDAITQEFMDLRT
RYTALVTFTTQHVKYISDALRRLEEEEKEVEEEKQARVDQVSDLLGWVKGLQQRSRGPTA
ESSLAAQQSMKHSCMLSQAITEQLSAKKDEVAEAIRNTQVFLMSKQANILSPEERSHVDA
QLDELTATYSQLCDTSTQQLQQLEQQLASEEEKKSLVAVAGVINLETVETFPVFQAAQRG
LIDQDTCYVLLESQLIMGGLLHPDLSLQFSLEQGLSEGLIDTKTKHSLSQLERALLVVKN
TKSSEGQQQNVLSVSAAMAHGLITQEEGLRILELQLNTGGLRTSTGLMITLKEAEEKQLL
TPVILAKLQGKLQHRELVDPNTAEQLNLHELRQRCVTDSESRLLLPVQQQPGGTVCLSSG
KIVGMFSAVQEGLIDRKVAVRLLEAQLFAGGIVDHRSGDRLTVNEALRGGLMDQELACAL
FARQLQNGGILDAFTEEHLHLEESIHRDLLSSGLAPVVLESLCTFAGMLWPESGEIMPIV
EALQQGVISGELSRNILKHRHVIGALYNPETLQLLPLTQPAEQYLDPSVVLFLKGTSIPD
VLSTKIESVIPAMNRSSRYSTWSVPPSLPPLPSGSSEAIELMVHLVAHSYVDAHTGKRLL
LLDPELNEMVKANLMVSEDLTDAKHIGSQSTLPTYEQGKLKVLQQLNLIDKDLTDTQQAE
ADQRNSPEFSERKESKNDAGTLEETNKYLYSHSPMVDSDSKAVRDIFDAEGLASPKKIHE
QKFNDSCHDAGRKTVEEEFLLLKESIFHKAKTDEVSPTGFQYKTDACAQNETVETKESMP
ITPPSNIHQSTEVEESQDMDLEQLAQELRQEGLLNLDGNKLLPDEAVAQDLLSGYMAVKL
MAEANLFGGFVDGTSGKSLTLDDVTQDLLEEDLMWRVLKADKTLSGVVDVDKNHVCSITE
ASRTGLIDPNTAARLLEAQVVSGGIVDLRQNQKVSVTTAASLGLIAENQKEDLVVLESAY
NGKKVDSAILLTKASLQLQIDGVVDPETKSPVPLEQAIQNKLIKPDDAYQILKKQVAEGG
IVHHASGLRLSVSDAVDRGLVNRSVASGLQELEWIFKGKMSPSSHPEAFILQASTGAIFD
PDSGCKLTLTEAVSKGLVDDSVADKAMTSSVVTQGVLDPQSACIVPFSELVKQGKIDLKT
GHRFLAVKPFRGIQGEKTGVKMTLPEAVASKKVDPIPSFRLLQSQANSGGIFDIATGERL
SLYEAHKRGLIEDNIVRLIATSQFLKGGIVDPVSGKQISNLDDAVDKGLISSQIALDILQ
KTASVEVKDDEEEIRDKMEREDAFVEFREVGQDDTEDQAHINVEEKPVKTEIKLSLDDEL
RDQRQTSPLNAIKSKRKKKDKKNKKEARLNRKDLSSQIDQVDAGIDGQSDANTAVVADLN
SNNICKKSHVYSQAANALTPNQDKKIAGNNLVKQSLMADPATLKHTEHVFESQKDQVKAA
LAKTTEKGKTEGLKKEEKKGNRTAAPAQEVKKINEVDLPQKHPLPDEEKAALILKANDSI
LKKGFVKGVSKKQTVTELQTSRNELAKKESQHPAVRDLKFRTLSSELSGEGNHNDKDNNG
SKHHHSSQFENTVKSKESKLEPAMVKEDAAVEGFLENGTTKTIPLKTSSEEQGKHGSPKE
YIQEIETDQLAPSKEKNKEIVSEKQREKNKIPKVRDAEQKNLLSPENMDSEVATISTVVV
VERTDLDKSAQKQTDIDDQSASDKMKASLVDEDVLKSDIQPTTQFVEFGAKPATITGDEK
IKMQQPPAGSNVSEIESVEGQKQNSDSLELAEDNSVQYESTNPACDTATDSWEEVRQECL
GHDQSIVALVSMVRHIEVQLKQQQQQSVGRSLITLDDIIRQAETLDLELCDLESEVNRAL
VAAEQMLKHQHEDIPPQLLLALEKDKQSLARGYEAARALSVDILQSLKDHKESRQAAITA
EKTCLEEQVENLLTWLVDTESRMNGGMVGVDKREKADKDVHCEQLLQQDLQSALTARSNE
VSSVAFNIQMFISERAQDLAPEQSRQLLRQLQQLQRTFHGTSGQAQAWADALSAQKEREA
EWQRRELEKKEVVQQQRAECSQKLEGLNMWLAEAASFLTGQEATAESADVNVLQEKQKKL
KAVQQDLQTKHEVLAEAIRSVEDLLTDKGDSLSPQERENLQVALTRMKEQYSTLTDAVEM
SLSDVDTAINTTVQQNMQKAKAEEEIQDTQSQINSLLNELSSLNQPDGTGDGSGAGDFAD
AASLPPEDAVALHTENLHVRILVMQAELQQLQNQQAQLLQITQTTRALLEQPDSTVPPEE
KQRLRVALDQLQTQHQDRLQSCQHRLRKSEALKDELTKFLQEHRSFVVWLDQSEEELRYL
GEGETDAQGLKDKLDDHRKLGEEVICHKADLRFVSISGQKVLDTVQGALEQSGGTNPALC
STSEMVTDKLQDANHRYTALHTKSAELGSRLSGLLERYQQYQDEVVSLHSWLSTQEQNQS
IVKPSGETDPQNLQNTLRHVQLLQDELAEHLVQLEKVKRAGRDLVSTDESPSLKAVDILC
AADGLQKRFDSLSSSVSERAEQLQTAVAQSVSVQEGLKCLLSWLDKLQTKPGPVEATAHA
VQDALTQNQKLRQELLSRQGSVEATRDSVSKFLNSSDAPMDPDLLSALDELTQRYTTAQT
CQAELEVELKALLPRLESYERLGYDLQVFTQSRLKALSPVGQPDRSIVDYRQTIEEVQSE
LEQEAGQLKTFCNLGTDLSQSKAFNNTQILLDNVKELSDEFNQLEDNVKQRLAAIQACDQ
QLVQFRGLSGSLLRWLQSAQDQLQSKEGSLTTEGLQRRVQQLKDLLNDWESQQSRVRELN
KTGSELESVIIHITGPQTKTGAPQINGSAGPSSVNGIHTCKDLTELQVAMSDVNGQYEAL
GAELKDHLGHQQASLGLRQKAKQGTEELKNWLTERELSLKQAQTASPSRPEVLRAQAQEN
KVLLSELAKHSGQVEELKSTLRKLIADSPDSPEVDSWRQQLQDIDSRWQTTNQKAAQRQT
ELEMSVDRLSSFASMANQLGPWLREKELMMSVLGPLSIDPNMLNTQKQQVQFMLREFETR
RPQFDQLTQSAEGILSQTGNSSEDSKDLVEVKAELGSISQQWEDLTQRLSQRSNHIDQAQ
GTSERFQALLRELSSSISTLSERLDAQASLSAQPEALKLRLQETGEIRSELERHRVELAE
AEQLCQELSAIVAEPYLKEELSKRLESISNPLKSLEERAADGLFQLQTALSSTQQFQQMF
EELRSWLDQQANARESFSDSLPCQPVAIRSLLAQTGELQRGIASQRGSYELIQAEGVSLL
ASLPAGGDERSALQSRLTTLKQDWEELNQRISDRESRLKMILTKADLYQQHKAELTSWLL
ECEQKEAEIQPSLNPLALNDALQKARSLSMDLERRQPLMEAFNTAVDQLLEQCCIGEEEV
RDEKAQINRRVDNLGERIHNRTSQLEELSGRLKEFEDGWQAAERRLEAAKHQIEVQEALG
PQACSAKSLERLRSQQDSLKSLKPQVVYLRDLAQGLVRDSPQTQEDRTMGVQRLQRQADD
LEKEFDDVTYKIEECCSSLESRLQGVSEVQSHIRDVFSRLADLDDELDSLSPVGRDADSL
ASQADSLQGFLSRLTHLRTELEGHASECTSMLRREGSSPDLLALRRETEALNRQAGKLNE
RGQAKLGQVEDAAERVHEFYRLVAELQDLLGSAEEGLTSQSIVGTEVEMIKQQLKDFKAV
EREQVDSIQPKLQHVNAVGQGLIQSAAKHTDTQGLEHDLETTNLQWNSLNKRVAERIAQL
QEALLHCGKFQDALEPLLSWLRDTEELVANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRP
TVEMIHAEGERIAATADPVDKEKIETQLHKLGERWADLLDKAGTRQRKLEELQVLALQFH
ESLEPLGEWLSTTERRLSSAEPMGTQTAKITQQIAKHKRQALNEEILGRKKTVDQAIKNG
QALLKQTTGEEVLLIQEKLDSIKSRYAEMTAGSSKALRILEQALQLASRFASAHEDLNQW
LDSVEAELNSVEPDATPAYQERQKKELKKVSAEKRLVLDTVNEVSNALLDLVPWRAREGL
DRLVADVNQRYRQADDTITQRVQLVQAAIQRSQQYEEAVDAELAWAAETERKLTSLGPLS
LEPDVTVAQLQVQRAFNIDIIRHKDTVDQLLATRDDILETCSDTQKDALIIKTNSLSTRY
DAVSQKHSERFSALEQAQVLVARFWETYEELEPWLGETETLITQLPPAAIDTDALRLQQD
QMRLLRESIAEHKPHIDKILKIGPQLAELSVQERETVTQRYTEAEKRYWVIKEGVKARAA
ALDEAVSQSTQFHDKMDPLLETLEGAVQRLRQPPSVAAEVEKIREQLAEHRAQGMELDKL
LPSFSALCARGEELIGRAAYDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGKLNDVLDLA
GKFWADVAALLSTLKDSQDIVKELEDPGVDPSLIKQQIEAAEAIKAETDGLREELEFVRT
LGADLIFACGETEKPEVKKTIDEMNGAWEGLNRTWRERMERLEEAMTASVQYQDALQNMF
DYLDNAVIKLCDMSAVGTDLGTVKQQIEELKQYKVEVYQQQIDMEKLCHQGELLLKKVSD
QTDRDMIQEPLTELRHLWDNLGDKINHRQHKLEAALLALGQFQHALSELQAWLNHTHTTL
DTQRPVSSDPKAIEIELAKHHVLRNDVLSHHATVENVNGAGAELLESSPGDEASHLRDQL
DQLNQSWQSLLLKTQERQKQLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPE
TAREQLQQHMELQAQLAQRADQYHRLQDQGESMLLARGGDESGPGTTQTQQNLSILQNKW
GSLNAKMDDRRAKLDEAIALATGFQSSLQDTINWLTQAEQTLNMAQPPSLLLDTVLFQID
EHKVFVNEVNTHREQVLALEKAGSQLRFSSLKQDVVLIKNLLLSVQARWDKLVQRSLDRG
RHLDEARKRAKQFHEAWRKLSDWLEEAEKRLDSELEISNEPDKIKVQLAKHKEFQKALGS
KQPVYDTTVRSGKAMRDKAQLPADTQKLDNLVGEVRDKWDTVCGKSVERFRQHKLEEALL
FSGQFAEALQALVDWLYRVEPQLTEDQPVHGDLDLVSNLMDSHKSFQKELGKRTSSVQTL
KRSARELMDTGRDDTAWVKVQLQELSTRWDTVCALSVTKQTRLQQALKQAEEFRTAVQVL
LECLSEAEQTLRFRGVLPEEAETLQALLHTHRDFMGTVDAKRTDVNKAAGMGEAILAVCH
PDSITTIKHWITIIRARFEEVLTWAKQHEQRLETALTEVLNNANLLEELLSWLQWAETTL
IQRDTESLPQDIPELKTLVAEHQMFIEEMTRKQPDVDKVTKTYKRKPAEASSSLAERRGA
RKSPFSGKQQQQQAAMQVSGGNPRLNQLCGKWQQVWLLALDRQRKLNDALDRLEELKEFA
NFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMTA
VADIFDRDADGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQI
GENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLEL
REKFILPEGGPQGLTTFRSRGRRSKPGSRNASPTRSSSSASHSGASLPSAPSAPTTPTTS
ASSRGAASGSKLKRPPLHSSRGSLTGENGGATPTSKPSRTVSQSNRPDPKRGGSTVSGAT
SRAGSQAGSRASSRRGSDASDASELQDSRSVCSDASDTPRRPGSGAKPSKIPTISKKAPS
PKTSAAMR
Download sequence
Identical sequences H2SL46
ENSTRUP00000013131 31033.ENSTRUP00000013131 ENSTRUP00000013131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]