SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013924 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013924
Domain Number 1 Region: 30-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-86
Family Calponin-homology domain, CH-domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-33
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-30
Family Spectrin repeat 0.00000251
Further Details:      
 
Domain Number 4 Region: 400-508
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-26
Family Spectrin repeat 0.00000266
Further Details:      
 
Domain Number 5 Region: 742-885
Classification Level Classification E-value
Superfamily EF-hand 4.11e-24
Family EF-hand modules in multidomain proteins 0.02
Further Details:      
 
Domain Number 6 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-20
Family Spectrin repeat 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013924   Gene: ENSTRUG00000005731   Transcript: ENSTRUT00000013988
Sequence length 897
Comment pep:known scaffold:FUGU4:scaffold_330:144871:159910:1 gene:ENSTRUG00000005731 transcript:ENSTRUT00000013988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVETQITYSNSYTIQHEEAYMIQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFH
ISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPKMLDAEDIVNT
PKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWI
RRTIPWLENRVSEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERVDHLAEKFKQKCSMHEAWT
AGKEDLLSQKDYETASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNARCQGICDQWDNLGTLTQKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAME
DLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERVATLGIHNEILKIAQTYGIKLSGIN
PYTTITSQDITTKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKM
EEISHVSVDISGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSM
EHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDD
FRACLISMGYDLGEVEFARIMTLVDANNTGVVTFQAFIDFMTRETAETDTAEQVMASFRI
LASDKNYITVDELRRELPPEQAEYCISRMTRYIGADGPSGALDYISFSSALYGESDL
Download sequence
Identical sequences H2SND8
ENSTRUP00000013924 XP_003978085.1.43653 31033.ENSTRUP00000013924 ENSTRUP00000013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]