SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013983 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013983
Domain Number 1 Region: 496-719
Classification Level Classification E-value
Superfamily NHL repeat 6.28e-36
Family NHL repeat 0.0000461
Further Details:      
 
Domain Number 2 Region: 327-423
Classification Level Classification E-value
Superfamily E set domains 2.67e-19
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 113-173
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.92e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 19-88
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000168
Family RING finger domain, C3HC4 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013983   Gene: ENSTRUG00000005754   Transcript: ENSTRUT00000014047
Sequence length 723
Comment pep:novel scaffold:FUGU4:scaffold_3238:198:6037:-1 gene:ENSTRUG00000005754 transcript:ENSTRUT00000014047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHDAGRTSPVVRQIDKQFLVCSICLDHYRNPKVLPCLHTFCESCLQNYIPPESLTLSC
PVCRQTSILPEKGVCALQNNFFITNLMEVLQRDSECSRPEACSVLESVSAAAAGKPLCCP
NHEGKVMEFYCESCETAMCLDCTEGEHREHETVPLRDVVEQHKAVLKTQLDAIRSRLPQL
TAAIELVSEISRQLNDRKSEAVAEISGTFEELERALHQRKTALVTDLENICTAKQKVLQA
QLSALLQGKEHIQSSCSFTEQALSHGSATEVLLVQKQMSERVTALARHDFPERPHQNAHL
DCLVETDGLRRSIQNLGVLVTTAAVAHSSVATGEGLRHAATGQHHAITVTTKDKDGELVR
TGNAVLKAEITSTDGSRGADTEISDNKNGTYEVGYTLHSEGEYAFALLLYGQHVRGSPFR
LRAVKPSDVPQSPDDVKRRVKSPSGSGGHIRQKAVRRPSSMYSTTKKKENPIEDELIYRV
GKTGATRAPPGGSRGRERGEFTNLQGISASSNGRVVVADSNNQCIQIFSNDGQFKMRFGV
RGRSPGQLQRPTGVTVDVNGDIVVADYDNRWVSIFSAEGKFKNKIGAGRLMGPKGVAVDK
NGHIITVDNKACCVFIFQSNGKLVTKFGGRGTADMFKFGSHGEGNGQFNAPTGVXVDSNG
NIIVADWGNSRIQVFDSTGSFLSYINTSADPLYGPQGLALTSDGHVAVADSGNHCFKVYR
YLQ
Download sequence
Identical sequences H2SNJ6
ENSTRUP00000013983 31033.ENSTRUP00000013983 ENSTRUP00000013983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]