SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014042 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014042
Domain Number 1 Region: 389-636
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-91
Family ABC transporter ATPase domain-like 0.000000871
Further Details:      
 
Domain Number 2 Region: 1043-1291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.41e-88
Family ABC transporter ATPase domain-like 0.000000904
Further Details:      
 
Domain Number 3 Region: 33-81,118-383
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 3.79e-62
Family ABC transporter transmembrane region 0.0004
Further Details:      
 
Domain Number 4 Region: 717-1036
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.96e-59
Family ABC transporter transmembrane region 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014042   Gene: ENSTRUG00000005770   Transcript: ENSTRUT00000014107
Sequence length 1295
Comment pep:novel scaffold:FUGU4:scaffold_48:115198:124822:1 gene:ENSTRUG00000005770 transcript:ENSTRUT00000014107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHDSKDDGAKNEKKKKNKKEKPPQEPMVGPITLFRFADRWDVVLLISGTVMAMVNGTVMP
LMCIVFGEMTDSFIYADMAQHNASGWSEFLLDSTTTILNSTLQEDMQRCVYRLLSYFFCR
FAIYYSVLGFVVLLAAYMQVSFWTITAGRQVKRIRSLFFHCIMQQEISWFDVNDTGELNT
RLTDDVYKIQEGIGDKVGLLIQAYTTFITAFIIGFTTGWKLTLVILAVSPALAISAAFFS
KVLASFTSKEQTAYAKAGAVAEEVLSAIRTVFAFSGQTREIERYHKNLRDAKDVGVKKAI
SSNIAMGFTFLMIYLSYALAFWYGSTLILNFEYTIGNLLTVFFVVLIGAFSVGQTSPNIQ
NFASARGAAYKVYSIIDNKPNIDSFSEDGFKPDFIKGDIEFKNIHFNYPSRPEVKILNNM
SLSVKSGQTIALVGSSGCGKSTTIQLLQRFYDPEEGAVFIDGHDIRSLNIRYLREMIGVV
SQEPVLFATTITENIRYGRLDVTQEEIERATKESNAYDFIMNLPDKFETLVGDRGTQLSG
GQKQRIAIARALVRNPKILLLDEATSALDAESETIVQAALDKVRLGRTTIVVAHRLSTIR
NADIIAGFSNGKIVEQGTHSQLMEIKGVYHGLVTMQTFHNVEEENTAMSELSAGEKSPVE
KTVSQSSIIRRKSTRGSSFAASEGTKEEKTEEVPCCQRRSSRKVPQDEDVPDVSFFKVLH
LNIPEWPYILVGLICATINGAMQPVFAILFSKIITVFADPDRDSVRRKSEFISLMFVVIG
CVSFVTMFLQGYCFGKSGEILTLKLRLRAFTAMMRQDLSWYDNPQNTVGALTTRLAADAA
QVQGAAGVRLATIMQNFANLGTSIIIAFVYGWELTLLILAVVPLIAAAGAAEIKLLAGHA
AKDKKELEKAGKIATEAIENVRTVVSLSREPKFECLYEENLRVPYKNSQKKAHVYGLTYS
FSQAMIYFAYAACFRFGAWLIEAGRMDVEGVFLVVSAVLYGAMAVGEANTFAPNYAKAKM
AASYLMMLINKKPAIDNLSEEGTSPEKYDGNVHFEGVKFNYPSRPDVTILQGLNLKVKKG
ETLALVGSSGCGKSTTIQLLERFYDPREGRVSLDGVNVKQLNIHWLRSQIGIVSQEPVLF
DCSLAENIAYGDNSRSVSMDEIVAAAKAANIHSFIEGLPQRYDTQAGDKGTQLSGGQKQR
VAIARAIIRNPKLLLLDEATSALDTESEKVVQEALDQARKGRTCIVVAHRLSTIQNADCI
AVFQGGVVVEKGTHQQLIAKKGVYHMLVTKQMGYH
Download sequence
Identical sequences H2SNQ5
ENSTRUP00000014042 ENSTRUP00000014042 31033.ENSTRUP00000014042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]