SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014209 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014209
Domain Number 1 Region: 1-117,156-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-67
Family Calponin-homology domain, CH-domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 6122-6277
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-19
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 3 Region: 5902-6024
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-16
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 6030-6140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000633
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 5 Region: 5814-5947
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000877
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 5524-5635
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000084
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 7 Region: 6572-6673
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 4957-5104
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000445
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 9 Region: 5692-5841
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000153
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 1493-1625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000798
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 11 Region: 4868-4995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000707
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 12 Region: 3700-3829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000672
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014209
Domain Number - Region: 2710-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000406
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1879-1971
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 531-665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00245
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 3639-3729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00907
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 3793-3929
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 3508-3627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.024
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014209   Gene: ENSTRUG00000005832   Transcript: ENSTRUT00000014274
Sequence length 6789
Comment pep:novel scaffold:FUGU4:scaffold_403:105118:166247:1 gene:ENSTRUG00000005832 transcript:ENSTRUT00000014274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQEQIQKKTFTNWVNAQLAKRRPPCMILDLFQDFRDGSRLLDLLEVMSGQRLSRERGRGM
FQHRSNIEKALSFLKAKSIKLVNINIPDIIDGKPSIILGLIWTIILQYHIEELASSLSFS
SRQSSMESLASLDSRSTLSSRSASSSPVPPRGSPLHRRFRVSAKKALLLWVREQCHNRLH
VKREGFKTSWRSGVVFLTILYALRPDVVDLSKARTRSNRQNLEEAFRVAESELRIPKLLD
PDDVDVRDPDEKSIMTYVAQFLQYSKDLPVAEEDVQASPDQKVKEVTCWLLQALDELLEG
WDSTEGESYAERYHVFHTFVVSFSEQRRSIIPLLTATRRSPNPSREQRALREAWDALAEY
VVFVHQLRDYRIQLDTSLPAPLDAVARWLLKTEGALGEEETEPQDHGRAADDAKEKQELL
KVCLEEMPQHLKTFQSFQNTDHDGNMMVPSDKLDELKRRFDDIFKCKFIMMAEKSFLELR
HTALDLLGQIRNKLQVWKRPYIAPEAVRVLLQEWHECVNTRQLPSLLESTLHKLKQVSEK
YSSKSALAADYPHVSQQVKQLEEDGAAALAGVATAKSIMGRVLSAWESYGDCLSSLQAWL
EQNSVRLSHGHRAEVTAECLAEWESRRARMTEAGTFLMEFTDPQTSRILEEELRRFHLRW
TEFTRTNSFHMNVVLLLSDSPQAGMSSADTQVSAQDVQTLEVDFDALSPSSECPADHLQK
LKLAVPEVRTVPLITFYRSVFQRLDWRLAELHFWITEAREVYQHLKTTDRQRRGQDPRAR
VLISRGLQLEGQVVTEDQDLQVMVMTSQKNSPIQYLHASAMQERVRGAVAQSQFSTRTIF
LRAKSLIGLNPDLRVNLRNGFEEAKHCLQEHILETISVFEDKSVSAEQASLKEETLRTLD
PELLEEFLRAAKGMEAFCSPSQLRDMEFYTQCVRTQWEDVRAEISDFLQQLSFEVTRKHF
NTAALQCELHLRSQVENRARVAKGCLVKRHLLACISADSSFVEAGRHLQALKELCDTLNP
EDAHRLAQTQLRECQTRLADIQRQFSGDQDVPLSDSRIPAIFSESLLTQREAPGSSDSPQ
ISEASPVTMKTVPAERIAKQQASEEEVKKREGLESVCYKTSRYDNCKRTLQAQLAKNELS
ITEVPPESVSLNGLHTRLQEIQFLRQETESLWAEYTNQCSQLSGTCHMEQEKEGLQEEWS
RQQSALQRRGSSLAAALRQIDSTQNHLVDFSDRLNRYLRQPKDIVGFTLVNSNILRDIKD
LDDNIQSELGQLGRLDPDSSDLDPRDCFPLSSEVKAHRTSLDHLRQQVRKSEAAARALDR
FLMSLRTLDEDVSGVHSAPSGDAQLLQDGRSKLAVMRQGVDSLKEKAPQLDLLLQGARLT
VTRDGAPASCLDMVAVLLRRLDEADDGLASQQRTLQKENQSKSLGLRKRTLLAELRTLQD
SIERQSLKEPTIPAVQHRLRALTELEGPLQTHQSELHDLRDLQEEQGGGENLYGELEAQW
KETQKAFSDRKKQCNILLDLLKKFQSCRGHLSSTMQTAEQAVNEQASYMGKDYLQRSITK
VSDIKEGLSGLGETIEEMRSVCRQLQSELKKSPDCSETSFEAEADALMDNWLDVTEKTDA
YLDNLRVGLELWEKQLSLGGEVDSWAGAKLALFAESHPFHNQQNISDMKEEICKNEENIE
HFHKKSVEIQEMLQSREAPLELQVMEGQLRKRMQQVKELFNDCADVFEELIAVKTHLAEK
IEECHSAVENIQSSLNEVDGSESNVEDQIQEEQAEAVLKEVGMVSSVASPQVMEALSVDC
RRLREAISHTKDLIHLKREERDKGLIQVLKDGRQSFEGWFQDLQLSVNECFENPESKTDV
EVYLQRLAAFLKSKDADRRLDHLKDQLQRGGKQIPPEQQTEVTEWLREQRGEVSTFRSHC
HNRQQQMESLLSELSSLQKQHDSFRDWLQTKEKQSVELVKVGVLLKDLQEESGRAEDLGE
LLGSVRRQGVRAEGLLKDSDNLIQRYRNLSVRLEERAEAQNVLQQQVESLKSQIEDVQMW
IRDQKKKLMSTSSHMPFDERIQIVKTIMCCKAEGDAKLQELKRRVQSASNLDIEEPKKQE
LQQQLRRAEEQWMSVVQTTKQNLDQELRRHSKSLLEQPDLEEHVKQQVHHTVQDSEEQWR
RVLQSAEDNMKKAEVQYSLSRELEAFRNQTAELFEITQDQSCTDPSWADKEESIPALLRE
LTDVVAELDQEVQDFLGSDELPTDISTLVDALCQQHDRFSVEPIKAAVGEDSESLKPLGN
QDEQQAAVSLMEKTESVETKLIPTRRKSKNSGPDESLQKLQSEENSERDGLICSSAVTEP
TGDNRPPPRKRSAVDLKLSSESASQEETESEREPGAQTSPLRALKTETVAEEAKETPATI
QDVSDASKRESKELKVSSQSPDEWVQNPEESYIQALSSASDVHKTAAENTIERSQLKSLT
LNHAQKTGNLLQSSLTKKSKKEAELQLVTDYRQQSQSAKTTLESLKMQLGAAQMSPEESS
SEQRERLSSLKKETEESRASLEQMVVAFDTLAPHLSQSERMTAQNEIRDLQESWSSLERD
IDRTLIQTELYSVETSNLLSSISNLHTNLETICKDVEAKYPDAQWSCRKAKELLVANAEV
KAAQQQHLQLQRLSEPLSLNSCLEKELTEVQQGLQKVRDQLAHTEGLVTSCMQRSGNPIM
EKMMVVMKDGLSWAKQTECIIEGRRTKVALLPEEVHQQLRDLKKLQLEVIAKQGQLRTLV
EEVTELLPELDQAEEVPVVNSTLELLQELSKLTTEKLTSTVGQVESGLQTREKLTEQIAD
LDSWVMAHLLREASKSADEDLSLAELDRRSGQTQENVVEAEKQLTVCEDLLMKINDISSE
LSITENSKLLKKLANLKEDIQAIRNYERANKKDLNDHTQVIALSNEGLNTVEKSLMQMLV
DVGRHRYPITKDSLQALEPLKHMVLEHKSQIDLLQPWVPQEKVKELYSVVSDLLSKMAAL
ERNSRDHETYLSMRQCVEDLRENIQEQVRQTKGDSMGQEKRYKLCQTLILKIPLIKSLSE
ETHSKLQMISASLYPSQLNAEQQRLKLHQESLETLEVTLHNNLSIIERDVLEDLDLDSEE
KATLAFLQRTQKELQRTPVLEPDEAAVQKEYQKIMTLKVMIKSRMRVVEFLRTRKRPRLE
GEFQNLKDLKDKVISECDSQMVNISQAREPLRSYTCAVKQAAQFLRDIELSLQPPQGPAG
LCSERIEETQRAVHALQQHFQTHVEHLQDQVIVHPYLSPQKVQQLQETILSQLLVRMSTL
QAKGHIQLEHLSRCAENNRKYTQCHEETLQSVKDIEENLLQVTRQKLASLADCVEQHDQL
TVRVIPEVQTLGEEVEAQLRCLKDLKECCTEQSCYRRREATLAALWRRLSRLHHCTWKLA
TRSEDRITEWSEIGDTVEKVSVVLEQVEAELPDGAGVKASSEELQDLLQSWEQYQDRLDC
EQRALSALELRTARLLGVPAHLEQAPPTPLCQKLQMMQARYSSVKKRSSEGLEVARMELE
EREKVREELHGVQLWLEAADVLLNEMEQGRSTEELQEVHRQLCTQKALLQAMMDRMKRKY
SDVQLLVPVELHGLLQEVQQSVQELEVKVVEAVDRSGPAYRLDAKLSEIQTGLRSVRQKL
EQRSSTVAQAEDTQKRVWDELDTWHSCLAQLESDAQDLEKPEDTVTITDKLTEVQQLHSQ
LAKQAERRTALIGKVTPWLQEHQEMINSSDSWMSEAQSWLAAPCTYAGAKCLSGRVRALQ
RVLDDSAQIRTALQGFGSVLEEMSQVCDVTALQEQLLTADRRVAEVQERFTAPLAQLQHA
VTKVESIEREVRQLEKDVAEIKKVLVSPESCPSLQKQRFKMVEQRVGSMRATVAQIQRCK
PDLGLPGNAEETLTVFTVVNQLQSLLQDLEKVRPSVHPSVPIVSVRSTNGCFQVITRLGE
LNGGANAERSNWFSLSRTSLEPVGVRAQAGEGEEFQQDLRSLFRCRSCDVFHLCTDSFSR
SCLLPSGARGRRRRRGPDPSAALQGAEQLAEATEAGASEASSEPSGPVRTQPESHSMVKT
DSAEKLSKPTSGAQQRLDSRDPSLEKSRRSGNTPEILNKIFGSSSSTGKRRCVCVTVRTK
PLEFGSSRLRPPNRLPPPLQEVNSPTSGGRSGQIEKGKRARSSATCGQRVLHEFREQLVQ
LEQRLLEAQSYLTGSGTVAMQRDAVESRLLTCQEIFLEIEQKVAELLDHPQLDGLGAVGS
QQEAAELLSSKLELLKAELVGVQQQLQQRRSEERGAALEQASDVTSCQTPQRREGNVDGT
WGRQLERPLESRLKRSSSFQTELYLEPPPPPKKKQETSRLYCRCVRLFAQELEQQLSEQR
GLTQAIALQGSRARPHDPPPGSPALPRDQDSWSDLRRRFLLLEENWLLSPSEVTDSFTGD
GAAQSGSETQTVKELQALTRALRALGPAETAIKSAEKRREEETGSVGPQDSGLFQVLHRT
PSCLSAIKDVLRWTAGGTEDEDGRRRRLLQTLTSELDALGAALTSQRSKFSGGQSSCVPQ
CLDDAFRVLSVIRASLTFREKRLGDLKQENIQQVRTRLPWIRANMMMSQRIRFNRCVNQT
AQGSSGVTGGSKLLATEVAPLRHDFCWTSFPTVQGELDQPLAGVCCHDNQEDSGVELQHH
HEQLVHSLEELLALGRDRLDAGPEVELRDRAGLRQQHAGHMKFLQFLDRHFRTLQYLSQS
APQRWEGGLQEEVARLRRRGLAKATTMQEILRVWSQWEEDSAWADSLLRPLQTSFPRMQE
EGASEEQISEKLSVYKGIREVLENNEARFGRMLEAGLWLQKAGCKGVGVSTANLVARWKT
LFGESEQEHSRLEKRWKLRCRFLHDFDALVEWMGGARRVIDTLDQLSGLEDVDADLSQRH
FVQAVELTKDLESRSGLKAAVVGAGAQMLQLRGDDEGDETPDPAQSCLQAQLTQVELDWS
GLLADVPAVQTALQERWLKMVGQQGALQVLQTWVDSAETRLEELLSRTRSSTTELSQQLK
DCRDLRTEMVSHQATLDSVDQPSHGCSTEHDHRRRCEQNQFAEEQGGLSRRWFRLQARLQ
CRVQEAQQELRSGAEQEVRLQRISRWAADQNRWVLAARTPSSRAELRRSRAACQLDVRQQ
LALLQEFSGEDQMCSRLFSQTQMLIQTCEGLGSQAASADQELAAAQQLWEHLEEELSQLA
MKTSSTCQSLRLHQPQICLQAHTDVHQQLQLLHEATSSSSSEWRRLIEAVSALSGVVSPA
AAALLAERAERERDRWSALRSELQRQLRKSGRLLQVWEGHCGRAAALTRRLQTLRRDAAA
MLGGAPAEGDVEQTAERIRRVEADLQGALEASRSLTDLLEPPAACLVQSELRLLSRDIQE
TIWNLRERLVFINFRNFSFKPTILLIKYLEELQRLQELSALLASLEEDLRLWQQRLEVQA
DQVGHSDLLQPCGRSADLDVLNELSRGVTPDDATARRLQLLDRRWAAAAARAEETCSELQ
TEALRRQSFEQKCQSWMSFLQRTEDDLAVDVAASYAGLRRQLCTHKRFQTELSIGHQILH
SVLADALRLLQRGEVDDRTGFILKLAHLREHWQGAVQRADQRRLLVEGLVKHWHAYRRSL
KKLQRFLADTRRLLPSAGPARCGVQQLRRSLQDLQRAELQFQRHQAGFVHTLDLGRQLFA
MADQETQEQLQVDLGTLQEDWDKLQNLLGRRTELTQTIIKKWRRCEDGLKDSMTRLKDLK
TRLNRSVPESDDELQGAEKSNQENEDSLEDWAQSLTELSAMKTDLSQYIIADDVLLLQEQ
VEHLHCQWEELCLKVSLRKQEIADRLNAWIIFHEKNKELCDWLTQMENKVVLSSDLNIEE
MVEKLKKDCMEEINLFSENKTHLKQLGEQLITASNRTKETEVNAKLKDVSDRWQHLFDHI
ETRVRKLKETLVTVQQLDKNMSNLRTWLSRVEAELAEPVVYEVCHAEEIQRKLTEQQDLQ
RDIERHTESVASVLTLCDLLLRDADACGSDSESDSIQQTSRSLDRRWRNICAMSLERRMR
IEETWRLWCKFLDDYSRFEDWLSGAELTAADPDSADVLYTGAKEELKKFEAFQRQVHERL
TQLELVNKQYRRLARENRMDAASRLKEMVQEGNRRWDNLQRRVASIIRRLRHFTSQREDF
EGTREGILVWLTEMDLQLTNVEHFSASDIEDKMRQLNGFQQEITLNTNKIDALIVFGENL
IQKSAPLDAALIEDELEELHSYCQEVFGRVARFHQRLVNRRPGRKVLEEEQELSDLEESP
GVNNGATWRQARKRRRKREEEEEVSAAGQQVACHLLAPPLERSGRETPVSVDSIPLEWDH
TVDVGGSSHEEDEEAAFFSALSGRVESVSDPPVWHQPGSPLKKGIPPEIHQQGYVKLMSE
CSGSVNDVKRVKLILNDHEEPEDPGLSCAADTQTGTGVIGRWELLQAQKVERETDAQQRQ
KLNSDLCDVTSWLGRVLPELERLQSFTPATSIRDFKVNVGKLKQSWTQACCSLESWERRL
HAALLQCQVRGQRSSWRRGVRFPAGKPTPSSLPLQEFHETLHSLVLWLAQAENKLAAVGA
AGPATPRSVLVEQRDALTALQEELQGRRRQVSSLQDVSSQLLLDAAGDDGVEAKEKVHVV
SNRLHLLLRQVDADLQRRLEVGRAEPARPEDEDEDGATPLQHQEVAARRAAAVGPAPPGR
EERRDAPPPRSLFSRVLRAAFPLQLVFLVLLVLACLVPLSEDDYSCALSNNFARSFYPML
RYTNGPPPT
Download sequence
Identical sequences H2SP72
ENSTRUP00000014209 ENSTRUP00000014209 31033.ENSTRUP00000014209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]