SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014622 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014622
Domain Number 1 Region: 34-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.11e-35
Family Ankyrin repeat 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014622
Domain Number - Region: 271-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.000602
Family SOCS box-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014622   Gene: ENSTRUG00000006010   Transcript: ENSTRUT00000014690
Sequence length 315
Comment pep:novel scaffold:FUGU4:scaffold_5:195629:196759:1 gene:ENSTRUG00000006010 transcript:ENSTRUT00000014690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGQAANMSLMDISKIFSLLQPKEEDEHSEQCQALNNAVSRDDVILLSELLSQGSYRKS
INALSGWGVPVTPLRTAAALGHLRCLEVLLDHGAEVDSLDVKAQTPLFTAVSGKHLDCVV
ALLKAGADPNGSQYNNCSPVLTAAREGDIDVLRELLRFGAEVDVKPKVPEWATNATACRG
PLYISAVYGHLDCFKLLLLHGANPNYNCTDEKMLARIKQPKTVVEMCLRYGCGVEYIQLL
IDFGADVYLPTLIVDKSTKQNEALALLLKARVCPKTLMAQTRLSIRRYLTLPDKEAGIDS
LDLPPMLRKYLKHST
Download sequence
Identical sequences H2SQD5
ENSTRUP00000014622 31033.ENSTRUP00000014622 ENSTRUP00000014622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]