SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014875 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014875
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-38
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 283-329
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014875   Gene: ENSTRUG00000006121   Transcript: ENSTRUT00000014943
Sequence length 331
Comment pep:novel scaffold:FUGU4:scaffold_197:306612:309212:-1 gene:ENSTRUG00000006121 transcript:ENSTRUT00000014943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCDEESVSLVSSSGRNLKEWLQEQFCDKPLEQDDMRLHNAAYVGDLDTLRNLLQEEDFKW
RINEKSVWCCGCLPCTPLRIAATAGHAACVSYLIAQGADVDLVDVKGQTALYVAVVNGHL
DCVRILLEAGANPNGSRHHRSTPLYHTARVGRLDILQELIRFKADVDMDHQLGPRLLLSA
RTLNTLVVCPLYISAAYHHLDCFRLLLQAGAQPDFNYTGPVCQEALTRGLASCLLDAVLR
HGCEVSFIHLLLDHGANPALVPWDESELEAPNRRKVDPEALQVFLEARRCPQRLTHLCRI
RIRRTMGKSRLNRVPSLPLPQPIKNFLLHQG
Download sequence
Identical sequences H2SR38
ENSTRUP00000014875 ENSTRUP00000014875 31033.ENSTRUP00000014875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]