SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014890 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014890
Domain Number 1 Region: 23-146,182-288
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-71
Family Calponin-homology domain, CH-domain 0.000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014890   Gene: ENSTRUG00000006127   Transcript: ENSTRUT00000014958
Sequence length 294
Comment pep:novel scaffold:FUGU4:scaffold_266:206969:211442:1 gene:ENSTRUG00000006127 transcript:ENSTRUT00000014958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRSPADSAANQEVARVPPRLLVEREVVQKRTFTRWINLHLEKCAPPIEVEDLFQDIQDG
YILMALLEELSGSKLLHGFKKSSHRIFRLNNIAKVLSFLEERNVKLVSIDAANVADGNAS
IILGLIWNIILFFQIKELTGNIRSQFPSSCSLSSIPTSAESETSCCSTASDERRAASAAM
REHNKAIKKLLQWVQKQTRRFGVAVQDFGKSWMSGLAFLAVIKSIDPSLVDMRKALLRSP
RENLEEAFRTAHYSLGIPRLLEPEDVMIDAPDEQSIITYVSQFLEHFPGLEEVG
Download sequence
Identical sequences H2SR53
31033.ENSTRUP00000014890 ENSTRUP00000014890 ENSTRUP00000014890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]