SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000015270 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000015270
Domain Number 1 Region: 9-214,260-370
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.78e-56
Family Calponin-homology domain, CH-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000015270   Gene: ENSTRUG00000006255   Transcript: ENSTRUT00000015339
Sequence length 372
Comment pep:novel scaffold:FUGU4:scaffold_30:172989:184750:-1 gene:ENSTRUG00000006255 transcript:ENSTRUT00000015339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPQKSPSSPKSPTPKSPSSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGINAINLP
LSPTHYELDPEDTMLEENEVRTMVDPNSKNDRKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLERINDSLKLSSRNIRWNVD
SVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQIEEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELDTQFADGVYLVLLM
GLLEGYFVPLYNFFLTPENFDQKVHNVSFAFELMQDGGLERPKPRPEDIVNCDLKSTLRV
LYNLFSRYRNFD
Download sequence
Identical sequences H2SS83
XP_003967160.1.43653 ENSTRUP00000015270 ENSTRUP00000015270 31033.ENSTRUP00000015270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]