SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000015489 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000015489
Domain Number 1 Region: 165-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.38e-42
Family Extended AAA-ATPase domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000015489
Domain Number - Region: 19-141
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0203
Family GidA-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000015489   Gene: ENSTRUG00000006343   Transcript: ENSTRUT00000015558
Sequence length 420
Comment pep:novel scaffold:FUGU4:scaffold_149:298818:301084:-1 gene:ENSTRUG00000006343 transcript:ENSTRUT00000015558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSDFLDGLKDNPYFGAGFGLVGVGTALAVARKGAQVGMVFFRRHYMITLEVPSRDKSY
HWLLSWITKHARHTQHLSVETSYLAHESGRVHTQFDFHPSPGNHIIWYGRKWIRVERTRE
KQMVDLHTGTPWESVTFTALGRDRQIFFNILQEARELALKQEEGRTVMYSAMGAEWRPFG
FPRRRRPLSSVVLEAGVGEKIVDDVKDFIGNPKWYTDRGIPYRRGYLLHGPPGCGKSSFI
TALAGELGYSICLMSLSDRSLSDDRLNHLLSVAPQQSIILLEDVDAAFVSRDLLPTENPL
AYQGMGRLTFSGLLNSLDGVASSEARIVFMTTNFIDRLDPALIRPGRVDMKQYIGYCTEW
QLQQMFQRFYPDEAASEGERFAERALAAHAEISAAQVQGHFLLHKMDPAGSIDNVAQIKQ
Download sequence
Identical sequences H2SSV2
31033.ENSTRUP00000015489 ENSTRUP00000015489 ENSTRUP00000015489 XP_003962178.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]